KEGG   Burkholderia oklahomensis E0147: DM82_3095Help
Entry
DM82_3095         CDS       T03284                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00010  Glycolysis / Gluconeogenesis
bok00620  Pyruvate metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM82_3095 (acoD)
   00620 Pyruvate metabolism
    DM82_3095 (acoD)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DM82_3095 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AIO65006
LinkDB All DBs
Position
1:3486107..3487627
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGQPFTAIPRSREADVEL
ALDAAHAAKAGWAATSAGERANALLRIADRMEANLTRLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPAIA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDGYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFMERALKRVESIKQGHPLDAQTMIGAQASSEQLEKILSYIDIGR
KEGAQCLTGGERNVLGGELSEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKSEEEAL
EIANDTLYGLGAGVWTRDGNRAYRVGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaatttccgtaccgcaagcaatacggg
aatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttcgacaacgtctcg
cccgtgaccggccagccgttcaccgcgatccctcgctcgcgcgaagcggacgtcgagctc
gcgctcgacgccgcgcacgccgcgaaggccggctgggccgcgacgagcgcgggcgagcgc
gcgaacgcgctgctcaggatcgccgaccggatggaggcgaacctcacgcgcctcgcggtc
gccgagacgatcgacaacggcaagccgctgcgcgagacgaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gacatcggcggcgacatggtcgcctatcacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaacttcccgctgctgatggccgcgtggaagctcgcgcccgcgatcgcg
gccggcaactgcgtcgtgctgaagccggccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctgaacatcgtcaacggcttcggg
ctcgaggcgggcaagccgcttgcgtcgagcaagcggatcgcgaagatcgcgttcacgggc
gagacgtcgacgggccgcctcatcatgcagtacgccagtgaaaacctgatccccgtcacg
ctcgagctcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
ggctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctcaaccagggcgaggtc
tgcacgtgcccgtcgcgcgcgctcgtcgaggagagcatctacgagcgcttcatggaacgc
gcgctcaagcgcgtcgaatcgatcaagcaaggccacccgctcgacgcgcagacgatgatc
ggcgcgcaggcgtcgtccgagcagctcgaaaagatcctgtcgtacatcgacatcggccgc
aaggaaggcgcgcagtgcctgacgggcggcgagcgcaacgtgctcggcggcgagctgtcg
gaaggctattacgtgaagccgaccgtgttccgcggtcacaacaagatgcgcatcttccag
gaggagatcttcgggccggtgcttgcggtgacgacgttcaagtccgaggaggaagcgctc
gagatcgcgaacgacacgctgtacggtctgggcgcgggcgtctggacgcgcgacggcaac
cgcgcataccgcgtcggccgcggcatccaggcgggccgcgtgtggacgaactgctatcac
gcgtatccggcgcatgcggcgttcggcggctacaagcagtcggggatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system