KEGG   Burkholderia oklahomensis E0147: DM82_3368Help
Entry
DM82_3368         CDS       T03284                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00550  Peptidoglycan biosynthesis
bok01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DM82_3368 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DM82_3368 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bok01011]
    DM82_3368 (mrdA)
Enzymes [BR:bok01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DM82_3368 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:bok01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   DM82_3368 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AIO67427
LinkDB All DBs
Position
1:complement(3771445..3773817)
Genome map
AA seq 790 aa AA seqDB search
MTEFKDTQQQLSKFRLRVAAAGVFVFVCFGLLATRFFYLQVWQHGKYALQAEENRISVAP
IVPNRGIITDRNGVVLAKNYSAYTLEITPSKLTDSLENTINALSEVVQIDARDRRRFKKL
QEDSKNFESLPIRTRLTDDEVARFTAQRWRFPGVDVRARLFRQYPLGPTAAHVIGYIGRI
SKRDQDRIDAMSDENDSDPETYDPRRDANNYKGTDYIGKVGVEQSYETELHGITGFEEVE
VTAGGRPVRTLSRTQATPGSNLVLSLDIGLQQVAEQAFAGKRGALVAIEPKTGDVLAFVS
SPSFDPNSFVDGIDQQTWDELNNSPDKPLLNRPLHGTYPPGSTYKPFMALAGLALGKRSP
GWGFQDPGYFTFGGHTFRNDVRSGQGWVDMNKAIMVSNDTYFYMLARDLGVTAIANFMKP
FGFGQLTGIDVQGEARGVLPSPEWKKKTFKKAAQQKWFDGETISLGIGQGYNSFTILQLA
HATATLANDGVVMKPHLVKEVENPISRERHLTVPKESGAIPLKQSDLDVVKRGMENVVEN
PSGTAFKVFRGAPYLAAGKTGTAQVFSLQGGNYRGHLLAEHLRDHALFIAYAPADHPQIA
IALIVENGGWGARSAGPIARRVLDFYLLDRKNPATEAAAVAAAASATEPVNAPVIGDATK
PVGVAAGFKALPQPTPPAAASGTEAASGASGAAASDENAGAGAAATGAATHAAGAAPSAT
GGASSAPATAGSAASAPPAARRPPPRKPRRAPASDAAITAAAPRDDQRKSPRDDNRALPA
EKPARGGIDE
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattcaaggacactcaacagcagctctcgaagttccgcctgcgcgtcgcggcg
gcgggcgtgttcgtgttcgtctgcttcggcctgctcgccacgcggttcttctacctgcag
gtctggcagcacggcaagtacgcgctgcaggccgaggagaaccggatctcggtcgcgccg
atcgtcccgaaccgcgggatcatcaccgaccgcaacggcgtcgtgctcgcgaagaactac
tccgcgtacacgctcgagatcacgccgtcgaagctgaccgactcgctcgaaaacacgatc
aacgcgctgtccgaagtcgtgcagatcgacgcgcgcgaccgccgccgcttcaagaagctg
caggaggactcgaagaacttcgagagcctgccgatccgcacgcgcctgaccgacgacgaa
gtcgcgcgcttcaccgcgcagcgctggcgcttcccgggcgtcgacgtgcgcgcgcgcctg
ttccgccaatatccgctcggcccgacggccgcgcacgtgatcggctacatcggccggatc
tcgaagcgcgaccaggaccgcatcgacgcgatgagcgacgagaacgacagcgatccggaa
acctacgatccgcgccgcgacgcgaacaactacaagggcaccgactatatcggcaaggtc
ggcgtcgagcagagctacgaaacggagctgcacgggatcacgggcttcgaggaagtcgag
gtgacggcgggcgggcggcccgtgcgcacgctgtcgcgcacgcaggcgacgcccggcagc
aacctcgtgctgtcgctcgacatcgggctgcagcaggtcgccgagcaggcgttcgccggc
aagcgcggcgcgctcgtcgcgatcgagccgaagacgggcgacgtgctcgcgttcgtgtcg
tcgccgagcttcgacccgaattcgttcgtcgacggcatcgaccagcaaacctgggacgag
ctcaacaactcgcccgacaagccgctcctgaaccgcccgctgcacggcacctatccgccc
ggctcgacgtataagccgttcatggcgctcgcgggcctggcgctcggcaagcgctcgccc
ggctggggcttccaggatcccggctacttcacgttcggcggccacacgttccgcaacgac
gtgcgctcggggcagggctgggtcgacatgaacaaggcgatcatggtgtcgaacgacacg
tatttctacatgctcgcgcgcgacctcggcgtgaccgcgatcgcgaacttcatgaagccg
ttcggcttcggccagttgacgggcatcgacgtccagggcgaggcgcgcggcgtgctgccg
tcgcccgaatggaagaagaagacattcaagaaggccgcgcagcagaagtggttcgacggc
gagacgatcagcctcggaatcggccagggctacaactcgttcacgatcctgcagctcgcg
cacgcgaccgcgacgctcgcgaacgacggcgtcgtcatgaagccgcacctcgtgaaagag
gtcgagaacccgatttcgcgcgagcggcacctgaccgtgccgaaggaaagcggcgcgatc
ccgctcaagcagagcgacctcgacgtcgtgaagcgcgggatggagaacgtcgtcgagaat
ccgtccggcaccgcgttcaaggtgttccgcggcgcgccgtacctcgcggcgggcaagacc
ggcaccgcgcaggtgttctcgctgcagggcggcaactaccgcggccacctgctcgccgag
catctgcgcgaccacgcgctcttcatcgcatacgcacccgccgaccatccgcagatcgcg
atcgcgctgatcgtcgagaacggcggctggggcgcgcggtccgcgggcccgatcgcgcgg
cgcgtactcgatttctatctgctcgaccgcaagaatccggcgacggaagcggcagccgtc
gcggcggccgcgtcggcgaccgagccggtcaacgcacccgtgatcggcgacgcgacgaag
cccgtcggcgtggcggccgggttcaaggcgctgcctcagccgacgccgcccgcggcggcg
agcgggacggaggcggcgtcgggcgcaagcggggcggcggccagcgacgaaaatgctggc
gccggcgccgcagccaccggcgctgccacccatgcggccggcgccgcgccgagcgcaacg
ggcggcgcttcaagcgcccccgcgacggccggcagcgccgcgagcgcgccgcctgcggcc
cgccgcccgccgccgcgcaaaccgcgccgcgcgccggcgagcgacgcggcgatcaccgcc
gccgcaccgcgcgacgaccaacggaagtccccacgggacgacaaccgcgccctccccgcc
gagaagccggcgcggggcggcatcgacgaataa

DBGET integrated database retrieval system