KEGG   Burkholderia oklahomensis E0147: DM82_3373
Entry
DM82_3373         CDS       T03284                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00970  Aminoacyl-tRNA biosynthesis
bok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bok00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DM82_3373 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bok03029]
    DM82_3373 (gatA)
Enzymes [BR:bok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DM82_3373 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DM82_3373 (gatA)
Mitochondrial biogenesis [BR:bok03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DM82_3373 (gatA)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AIO64917
LinkDB
Position
1:3777478..3778974
AA seq 498 aa
MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDADLTLAQAKAADAALA
QGVAGPLAGLPVAHKDVFVTRGWRSTAGSKMLANYTSPFDATVVARLAKAGMVTLGKTNM
DEFAMGSSNENSAFGPVKNPWDTSAVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPAS
FAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMAQCAADCALLLNAMAGFDERDSTSLERA
DEDYTRHLGKTWSAGADAGKPLAGLRIGLPNEYFGAGLADDVRAAIDAALKQYEALGATL
VPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLLDMYKKSRAEGFGPE
VKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKQCDVIMGPASPSVAWDIGAK
GDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFDEARMLQVAD
AFQRATDWHEQKPAGVQA
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgcacgcaaaaagcctgaccgaactgcgcgccgcgctcgatgccaaggaatgctcggcc
gtcgagcttgcgcagcactatttgaaacggatcgacgccgcgcgcgatctgaacgcgttc
gtccacgtcgacgcggatctcacgctcgcgcaggcgaaggccgccgacgccgcgctcgca
cagggcgtcgccggcccgctcgccggcctgccggtcgcgcacaaggacgtgttcgtcacg
cgcggctggcgctcgaccgccggctcgaagatgctcgcgaactacacgagcccgttcgac
gcgaccgtcgtcgcgcgcctcgcgaaggcgggcatggtcacgctcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgagaactccgcgttcggcccggtgaagaacccg
tgggacacgagcgcggtgccgggcggcagctcgggcggcagcgcggccgcggtcgccgcg
cgcctcgcgcccgccgcgacgggcaccgacaccggcggctcgatccgccagccggcgtcg
ttcgccggcgtgacgggcatcaagccgacctacggccgcgtgtcgcgctacgggatgatc
gcgttcgcgtcgtcgctcgaccagggcggcccgatggcgcagtgcgccgccgactgcgcg
ctcctgctgaacgcgatggcgggcttcgacgagcgcgactcgacgagcctcgagcgcgcc
gacgaagactacacgcgccacctcggcaagacgtggtcggccggcgccgacgcgggcaag
ccgctcgccggcctgcgcatcggcctgccgaacgaatacttcggcgcgggccttgccgac
gacgtgcgcgccgcgatcgacgccgcgctcaagcagtacgaagcgctcggcgcgacgctc
gtgccggtgtcgctgccgaagaccgagctgtcgattcccgtctattacgtgatcgcgccg
gcggaggcgtcgtcgaacctgtcgcgtttcgacggcgtgcgctatggccatcgcgcggcc
gagtaccgcgatctgctcgacatgtacaagaagtcgcgcgccgaaggcttcggtccggaa
gtgaagcgccggatcctcgtcggcacgtacgtgctgtcgcacggctattacgatgcgtat
tacctgcaggcgcagaagatccgccggatcatcgcgcaggatttccaggaggcgttcaag
cagtgcgacgtgatcatggggccggcgtcgccgagcgtcgcatgggacatcggcgcgaag
ggcgacgatcccgtccagatgtacctcgcggacatctacacgctgtcggtgagcctggcc
ggcctgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcgaagcgcccg
gtcggtctgcagatcatcggcaactatttcgacgaagcccggatgctgcaggtcgccgac
gcgttccagcgcgcgaccgactggcacgaacagaaaccggcaggagtgcaagcatga

DBGET integrated database retrieval system