KEGG   Burkholderia oklahomensis E0147: DM82_4049
Entry
DM82_4049         CDS       T03284                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase family protein
Organism
bok  Burkholderia oklahomensis E0147
SSDB
Motif
Pfam: Pyr_redox_2 Patatin DUF3734 Pyr_redox Pyr_redox_3 Reductase_C K_oxygenase DAO NAD_binding_8 AlaDh_PNT_C 3HCDH_N GIDA
Other DBs
NCBI-ProteinID: AIO71000
UniProt: A0A381IKN2
LinkDB
Position
2:358800..361073
AA seq 757 aa
MRDADYLLVGGGIASVTAARSLRGEDASASIAILCGEPVLPYQRPPLSQEFLIGTEQAAT
ITLHDAAFYASQRIDVVLGARAERLDPAKRIVRASNGAAFRYRKLLIATGATAKMPALPG
VELDGVHVLHTIAQAQTLKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVEHEPHL
MPTLRAPALASHFDALCKARGIDVLTSREVRRVLGAQRVEAVETSDGETRPCDLFVAAVG
VTPNCGWLEGSGLALGDGIEVDAFLQTADPNVFAAGDVAHFDDPIFGVRRRIEHWDNAVR
QGKIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYQAGVTETIERGSFDDRSYALLYLA
DDVLRAAFTIDRPAVEIAALNDAIKLRVNVAAQKAKLSDPNFPLDKLPVQTMLILQGGGA
LGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGAAKALEAFWRDLSIALPSL
YGSPWHQAWLSAYVLSFGVPSFLKPQWSRLGFGIDQLRAKWTSFFDATSIEKLVTRYVDF
DSLGTSPTRLLISAVDVETGEPRIFDSYVDRLSPAHLLASGSLPPGMPWTVVDGRPYWDG
GVISNSPLDLVIERCGQIGGRVFIIDLFSGTKTLPTNLVEVMLRREEITYMDRVRNDLRF
EEYASDFGDLVDGILAHVDEQTANEIRQQPLYIRLMGNRAALDIARITLNRDGQLSFIED
YDFSSDAIAQLQKQGYDAALVALANGRANRRRKHRGA
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgcgtgatgccgactatctgctcgtcggcggcggaatcgcaagcgtcaccgccgcgcgg
tcgctgcgcggcgaggacgcgtcggcgagcatcgcgatcctgtgcggcgaacccgtcctg
ccctatcagcgcccgccgctcagtcaggaattcctgatcggcaccgagcaggccgcgacc
atcacgctgcacgacgcggcgttctacgcgtcgcagcgcatcgatgtcgtgctcggcgcg
cgcgccgagcgtctcgatcccgcgaagcggatcgtgcgcgcgtcgaacggcgcggcgttc
cgctatcgcaagctgctgatcgcgacgggcgcgaccgcgaagatgcccgcgctgcccggc
gtcgagctcgacggcgtgcacgtgctgcacacgatcgcgcaggcgcagacgctgaaggac
gcggccgcgcacgcgcgccgcgcgacggtgctgggcggcggctttctcggcgtcgagatc
gccgcgacgctgcaggcgctcggcttgcaggtgacgctcgtcgagcacgagccgcatctg
atgccgacgctgcgcgcgccggcgctcgcgagccatttcgacgcgctgtgcaaggcgcgc
ggcatcgacgtgctgacgagccgtgaagtgcgccgcgtgctcggcgcgcagcgcgtcgag
gcggtcgagacgagcgacggcgagacgcggccgtgcgatctgttcgtcgcggcggtcggc
gtgacgccgaactgcggctggctcgaaggcagcggcctcgcgctcggcgacggaatcgaa
gtcgacgctttcctgcaaaccgccgatccgaacgtgttcgcggccggcgacgtcgcgcat
ttcgacgatccgatcttcggcgtgcggcggcggatcgagcactgggacaacgcggtgcgg
cagggcaagatcgccgcgcgcaacatgctcggccaccggctgccgtatcgcgacgtatcg
attttctacggcagcgtgttcgggctgtcgtacaacctgctcggctatcaggccggcgtg
accgagacgatcgagcgcggctcgttcgacgatcgttcgtacgcgctcctctatctcgcc
gacgacgtgctgcgcgccgcgttcacgatcgaccggccggccgtcgagatcgccgcgctg
aacgacgcgatcaagctgcgcgtgaacgtcgccgcgcagaaggcgaaattgagcgatccg
aactttccgctcgacaagctgccggtgcagacgatgctgatcctgcaaggcggcggcgcg
ctcggcgcgttcgaatgcggcgcggtcaaggcgctcgagcagcatggcgtgcggcccgac
gtgatctcggcggtgtcgatcggcgcgttcaacggcgcgatcgtcgcgagccatccgaag
ggcgcggccaaggcgctcgaggcgttctggcgcgacctgtcgatcgcgctgccgtcgctg
tacggctcgccgtggcaccaggcgtggctgtccgcgtacgtgctgtcgttcggggtgccg
agtttcctgaagccgcaatggtcgcggctcggcttcggcatcgatcagctgcgcgcgaaa
tggacgagcttcttcgacgcgacgtcgatcgagaagctcgtcacgcgctacgtcgatttc
gattcgctcggcacgagcccgacgcgcttgctgatcagcgcggtcgacgtcgagacgggc
gagccgcgcatcttcgacagctacgtcgatcgcctgagccccgcgcatctgctcgcgagc
ggcagcctgccgcccgggatgccgtggaccgtcgtcgacggccggccgtactgggacggc
ggcgtcatcagcaattcgccgctcgatctcgtgatcgagcgctgcggacagatcggcgga
cgcgtgttcatcatcgatctgttctcgggcacgaagacgctgccgacgaatcttgtcgaa
gtgatgctgcgacgcgaggaaatcacgtacatggaccgcgtgcgcaacgatctgcgcttc
gaggaatacgcgagcgacttcggcgatctcgtcgacggcatcctcgcgcacgtcgacgag
cagaccgcgaacgagatccgccagcagccgctgtacatccggctgatgggcaaccgcgcg
gcgctcgacatcgcacggatcacgctgaatcgcgacgggcagctgtcgttcatcgaggac
tacgatttttcgtcggacgcgatcgcgcagctgcagaagcagggctacgacgcggcgctc
gtcgcgctcgcgaacggccgcgcgaatcgccggcgcaagcatcgcggcgcgtga

DBGET integrated database retrieval system