KEGG   Burkholderia oklahomensis E0147: DM82_4404
Entry
DM82_4404         CDS       T03284                                 

Definition
(GenBank) FAD binding domain protein
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00330  Arginine and proline metabolism
bok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    DM82_4404
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     DM82_4404
SSDB
Motif
Pfam: Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_2 Thi4 HI0933_like GIDA NAD_binding_9 Fer2_BFD DAO FAD_binding_3 Pyr_redox_3 Lycopene_cycl AlaDh_PNT_C 3HCDH_N Pyr_redox XdhC_C Amino_oxidase TrkA_N UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AIO68558
LinkDB
Position
2:788656..789948
AA seq 430 aa
MTNEHLAVDVAIVGAGPAGLAAAQAVAKSGRTVAIVDDNPRAGGQIWRQGPDVAPSAPAR
ASLDVLRQPNVRHLAATRVVAAPRADTLLLEDAEHGLLLDYRKLILCCGARELLLPFPGW
TLPGATGAGGLQALIKGGMPVRGERVVIAGSGPLLIASLATARAAGAQVVAVVEQARLDA
LAHFALSLAATPSKLAQAARLTRGFAGTRYLTGAVVREAHGDARVRAVTIERNGARETID
CDRVACGFGLVPNLTLALALGCAVRDRAIAIDDAQRTSVEHVYAAGECTGVGGVELARIE
GELAGLAASGADATPDGRARFAALLRRRATWRRFAARGADTFALREAARALPPDDTLLCR
CEDVTIGAVRAHASARDAKLQTRCGMGACQGRVCGAAAHAYFGWDDTPPRPPFSPARIDT
LLVATDDALL
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgacgaacgagcatctggcggtcgatgtcgcgatcgtcggcgcggggccggctgggctc
gccgccgcgcaggcggtcgcgaaaagcggccgcacggtcgcgatcgtcgacgacaacccg
cgcgccggcgggcagatctggcggcaggggccggacgtcgcgccgagcgcgccggcgcgc
gcgagcctcgacgtgctgcggcagccgaacgtgcgccatctcgcggcgacgcgcgtcgtc
gccgcgccgcgggccgacacgctgctgctcgaggatgcggagcacgggctgctgctcgac
taccggaagctgatcctgtgctgcggcgcgcgcgaactgctgctgccgttccccggctgg
acgctgcccggcgcgacgggcgcgggcgggctgcaggcgctgatcaagggcggcatgccg
gtgcgcggcgagcgcgtcgtgatcgcgggcagcgggccgctcctgatcgcgtcgctcgcg
accgcccgcgcggcgggcgcgcaggtcgtcgcggtcgtcgagcaggcgcggctcgatgcg
ctcgcgcatttcgcgctgtcgctcgcggcgacgccgtcaaagctcgcgcaggcggcgcgg
ctcacgcgcggcttcgccggcacgcgctatctgacgggcgcggtcgtgcgcgaagcgcac
ggcgatgcgcgggtgcgcgcggtgacgatcgaacgcaacggagcgcgcgagacgatcgac
tgcgatcgcgtcgcatgcggcttcggcctcgtgccgaacctgacgctcgcgctggcgctc
ggctgcgcggtgcgcgaccgggcgatcgcgatcgacgacgcgcagcgcacgtcggtcgag
cacgtttatgcggcgggcgaatgcacgggcgtcggcggcgtcgagctcgcgcggatcgaa
ggcgagctcgccgggctcgcggcgagcggcgccgacgcgacgccggacggccgcgcgcgt
ttcgccgcgttgctgcgccgccgcgcgacgtggcggcgcttcgcggcgcgcggcgccgat
acgttcgcgctgcgcgaagcggcccgcgcgctgccgcccgacgacacgctgctgtgccgc
tgcgaggacgtgacgatcggcgcggtgcgcgcgcacgcgtcggcgcgcgacgcgaaattg
cagacgcgctgcgggatgggcgcgtgccagggacgcgtgtgcggcgcggcggcgcacgcg
tatttcggctgggacgacacgccgccgcgcccgccgttctcgcccgcgcgaatcgacacg
ctgctcgtcgcgaccgacgatgcgctcctataa

DBGET integrated database retrieval system