KEGG   Burkholderia oklahomensis E0147: DM82_4611Help
Entry
DM82_4611         CDS       T03284                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00440  Phosphonate and phosphinate metabolism
bok01100  Metabolic pathways
bok01120  Microbial metabolism in diverse environments
bok01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM82_4611 (aepX)
Enzymes [BR:bok01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DM82_4611 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD
Motif
Other DBs
NCBI-ProteinID: AIO69699
LinkDB All DBs
Position
2:complement(1037747..1039435)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSSELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILRFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAALVLAASRGAGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAETGELASLACAAERLSGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFALCSAADDRGLFGQKALLRRVSSDASEGEPHGRWIGLLNV
RGAGIARLKAMLDTLKARADFDSLDLPALLNALVDAGEKIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNTANGGAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcgacggatgctc
acgagcagcgagctcgaattcctgatggaggcgcacaacggcctgtccgcgcggatcgtc
cgcgaggcgggcttcaaggggatctgggcgtcgggcctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgctggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgccgaggcgggcgcggacgcgatcctgatccacagcaagctgtcgcgg
cccgacgagatcctgcggttcgcgcgcgaatggagcggccgcgcgccgctcgtcatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtccgcgtccgcgatgcaggcggtcgcccgcgaa
attcaggacagcgagacactcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccgcctgcaggatgccgacgaatactcggccgccgagcggatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgctcgtgctcgcggcgagccgcggcgcggggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagccgctcttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctatcgc
gccgacgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcggaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgagcgcctctcgggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgatctcgccgagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgcgacttc
gcgttgtgctcggccgccgacgaccgcgggctgttcggccagaaggccctgctgcgccgc
gtgtcgagcgatgcgagcgaaggcgagccgcacggccgctggatcggtctcctcaacgtc
cgcggggcgggcatcgcgcggctgaaggcgatgctcgacacgctgaaggcccgcgccgat
ttcgattcgctcgatctgccggcgctcctgaacgcgctcgtcgacgcgggcgagaagatc
gaggtgcaatacgtgcacggccactggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggaacagaacacggccaacgggggc
gcgagatga

DBGET integrated database retrieval system