KEGG   Burkholderia oklahomensis E0147: DM82_5646
Entry
DM82_5646         CDS       T03284                                 

Definition
(GenBank) FAD binding domain protein
  KO
K09471  gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00330  Arginine and proline metabolism
bok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    DM82_5646
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     DM82_5646
SSDB
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_3 FAD_binding_3 Thi4 NAD_binding_8 HI0933_like Pyr_redox_2 Lycopene_cycl
Other DBs
NCBI-ProteinID: AIO69771
LinkDB
Position
2:2263812..2265104
AA seq 430 aa
MQNYYEATATRTPYPALADRIDADVCIVGGGLAGLSTALGLVERGVRDVAVLDAQTVGFG
ASGRNGGFVFGGYSLDNADLLRTLGPESARALYRLTIDAVDLIRARAARYGIDCELVDGG
AILANWFDDPARLDAPRKLMKEAFGVEWEPLDANELRTRLKTDRYHGGLLERNAFHFHPL
KYVLGVAAAAARGGARIHEHSAARAIRRDGAGFVVATDGGAVHARRVVFAGGGYARGVYP
RIERAVLPIATYVIATEPLGARLADAIACRSAVYDTRFAFDYYRPLADTRILWGGRISVL
ERGPDAIARLLRRDLVRVYPQLRDVAVQFAWGGLMSYARHKMPQIGRDADGVWHAVGFGG
HGMAPTTVAGEVLAAALAERQPVPDGFARFGLTRTFGLAGLAAAQLTYSAYEARDALAAR
RRLRSGKPVF
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcagaattactacgaagccaccgcgacgcgcacgccctaccccgcgctcgccgaccgc
atcgacgccgacgtctgcatcgtcggcggcggcctcgcgggcctgtcgacggcgctcggg
ctcgtcgagcgcggcgtgcgcgacgtcgcggtgctcgacgcgcagacggtcggcttcggc
gcgtcgggccgcaacggcggcttcgtgttcggcggctacagcctcgacaacgcggatctc
ctgcgcaccctcggccccgagtccgcgcgcgcgctctatcggctgacgatcgacgcggtc
gacctgatccgcgcgcgcgccgcgcgctacggcatcgactgcgagctcgtcgacggcggc
gcgatcctcgcgaactggttcgacgatccggcgcgcctcgacgcaccgcgcaagctgatg
aaggaagcatttggcgtcgaatgggagccgctcgacgcgaacgagctacgcacgcgcctg
aaaaccgaccgctatcacggcggactcctcgagcgcaacgcgttccacttccatccgctc
aagtacgtgctcggcgtcgcggccgcggccgcgcgcggcggcgcgcggatccacgagcat
tcggccgcgcgcgcgatccgccgcgacggcgcgggcttcgtcgtcgcgaccgacggcggc
gccgtgcatgcgcggcgcgtcgtgttcgcgggcggcggctatgcgcgcggcgtgtatccg
cgcatcgagcgcgcggtgctgccgatcgcgacctacgtgatcgcgaccgagccgctcggc
gcacggctcgccgacgcgatcgcatgccggtcggccgtctacgacacccgcttcgccttc
gactactaccggccgctcgccgacacccgcatcctgtggggcggcaggatctcggtgctc
gaacgcgggccggacgccatcgcgcggctgctcaggcgcgacctcgtgcgcgtctatccg
cagttgcgcgatgtcgccgtgcagttcgcgtggggcgggctcatgagctacgcgcgtcac
aagatgccgcaaatcggccgcgacgcggacggcgtctggcacgcggtcggcttcggcggc
cacggaatggcgccgacgacggtcgcgggcgaagtgctcgcggcggcgctcgccgaacgg
cagcccgtgccggacggcttcgcgaggttcggcctcacgcgcacgttcggcctcgccggg
ctggccgccgcgcaactcacgtacagcgcgtacgaggcgcgggatgcgctcgccgcgcgc
cgccgcctgcgttccggcaaacccgttttttag

DBGET integrated database retrieval system