KEGG   Burkholderia oklahomensis E0147: DM82_5964Help
Entry
DM82_5964         CDS       T03284                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00020  Citrate cycle (TCA cycle)
bok00190  Oxidative phosphorylation
bok00650  Butanoate metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01130  Biosynthesis of antibiotics
bok01200  Carbon metabolism
Module
bok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bok_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM82_5964
   00650 Butanoate metabolism
    DM82_5964
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DM82_5964
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DM82_5964
    1.3.5.4  fumarate reductase (quinol)
     DM82_5964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4
Motif
Other DBs
NCBI-ProteinID: AIO68514
UniProt: A0A381IIF5
LinkDB All DBs
Position
2:complement(2635377..2636078)
Genome map
AA seq 233 aa AA seqDB search
MAKRIFEIYRYDPDKDAAPRMQTYELELQHERMLLDALVKLKSVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIND
EPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDRATGERLDNLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcattttcgaaatctatcgctacgatccggacaaggacgcggcgccgcgc
atgcagacgtacgagctggagctccagcacgagcggatgctgctcgacgcgctcgtcaag
ctgaagtcggtcgacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggt
tcggacgcgatgaacatcaacggcaagaacggcctcgcgtgcctgacgaacctgaacgac
ctgccgcagaagatcgtgctgcgtccgctgccgggtctgcccgtcgtgcgcgacctgatc
tgcgacttcacgcagttcttcaatcagtaccactcgatccgtccgtacctgatcaacgac
gagccgccgcccgagaaggagcgcctgcagtcgccggaagagcgcgacgagctcgacggc
ctgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtggaat
ccggacaagttcgtcggcccggcgggcctgctgcaggcgtatcgcttcatcgcggacagc
cgcgaccgtgcgacgggcgagcgcctcgacaacctcgacgatccgtaccgtctgttccgt
tgccatacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaacccgacgaaggcg
atcggcaagatcaaggaattgatggttcgccgcgcggtctga

DBGET integrated database retrieval system