KEGG   Burkholderia oklahomensis E0147: DM82_5965Help
Entry
DM82_5965         CDS       T03284                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00020  Citrate cycle (TCA cycle)
bok00190  Oxidative phosphorylation
bok00650  Butanoate metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01130  Biosynthesis of antibiotics
bok01200  Carbon metabolism
Module
bok_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bok_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bok_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM82_5965 (sdhA)
   00650 Butanoate metabolism
    DM82_5965 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DM82_5965 (sdhA)
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DM82_5965 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     DM82_5965 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 DAO Thi4 Pyr_redox_2 HI0933_like GIDA Lycopene_cycl Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AIO68659
UniProt: A0A381II09
LinkDB All DBs
Position
2:complement(2636100..2637875)
Genome map
AA seq 591 aa AA seqDB search
MAAIKTSLPRRKFDVVIVGAGGSGMRASLQLSRAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGVALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTPRGHEEPINGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVEHVKNQKEHKPLPADAAEFSLERLAKLEKSTSGEYTQDIANDIRATMQKHAGVFRTS
KLLEEGVQQMAGLKERVTHVHLKDKSKVFNTARVEALELANLIEVARATMVSAEARKESR
GAHAHSDYEHRDDDNWLRHTLWFSEGDRLDYKPVHMKPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaacttccctgccgcgtcgcaagttcgacgtggtgatcgtcggcgcg
ggcggctcggggatgcgtgcgtccctgcaactgtcgcgtgcgggtctctccgtctgcgtg
ctgtcgaaagtgttcccgacccgttcgcacacggtcgccgcgcaaggcgggatcggcgcg
tcgctcggcaacatgagcgaagacaactggcactatcacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgtgaagcgccgaacgcc
gtgtacgagctcgagcacttcggcatgccgttcgaccgcaacgcggacggcacgatctat
cagcgcccgttcggcggccacaccgcgaactacggcgagaagccggtccagcgcgcgtgc
gcggccgcggaccgcaccggtcacgcgctgctgcacacgctgtaccagcagaacgtcgcg
gcgaagacgcagttcttcgtcgaatggatggcgctcgacctgatccgcgacgcggacggc
gacgtgctcggcgtcacggccctcgaaatggagacgggcgacgtctacatcctcgaaggc
aagaccacgctgttcgcgacgggcggcgcgggccggatcttcgcggcgtcgacgaacgcg
ttcatcaacacgggcgacggcctcggcatggcggcccgctcgggcgtcgcgctgcaggac
atggagttctggcagttccacccgacgggcgtcgccggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgagggcggcatcctgcgcaactcgaacggcgagcgcttcatggagcgc
tacgcgccgacgctgaaggatctggcgccgcgcgatttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtcggcccgaacaaggaccacgtgctgctcgacctgtcg
cacatcggcgccgagacgatcatgaagcgtctgccgtcgattcgcgagatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggaaccgatcccggtcgtgccgacgatccattaccag
atgggcggcatcccgaccaacatccacggccaggtcgtcggcacgccgcgcggccacgaa
gagccgatcaacggcttctatgcagtgggcgaatgctcgtgcgtgtccgtgcacggcgcg
aaccgcctcggcacgaactcgctgctcgatctggtggtgttcggccgcgcggccggcaac
cacatcgtcgagcacgtgaagaaccagaaggagcacaagccgctgccggcggacgccgcc
gagttctcgctcgagcgactcgcgaagctcgagaagtcgacgtccggcgagtacacgcag
gacatcgcgaacgacatccgcgcgacgatgcaaaagcatgcgggcgtgttccgcacgtcg
aagctgctggaagaaggcgttcagcagatggcgggcctgaaggagcgcgtcacgcacgtg
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaagcgctcgagctggcg
aacctgatcgaggtcgcgcgcgcgacgatggtgtcggcggaagcgcgcaaggaaagccgc
ggcgcgcatgcgcacagcgactacgagcaccgcgacgacgacaactggctgcgccacacg
ctgtggttcagcgaaggcgatcgcctcgactacaagcccgtccatatgaagccgctgacg
gtcgagtccgtgccgccgaaggcgcgtacgttctaa

DBGET integrated database retrieval system