KEGG   Burkholderia oklahomensis E0147: DM82_6174
Entry
DM82_6174         CDS       T03284                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain protein
  KO
K18249  anthranilate 1,2-dioxygenase ferredoxin reductase component [EC:1.18.1.-]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00627  Aminobenzoate degradation
bok01100  Metabolic pathways
bok01120  Microbial metabolism in diverse environments
Module
bok_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DM82_6174
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.-  
     DM82_6174
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox 3HCDH_N Pyr_redox_3 NAD_binding_7 XdhC_C AlaDh_PNT_C 2-Hacid_dh_C HI0933_like UDPG_MGDP_dh_N GIDA DAO XFP_C Lycopene_cycl NAD_binding_8
Other DBs
NCBI-ProteinID: AIO70440
LinkDB
Position
2:complement(2867426..2868661)
AA seq 411 aa
MSTSDPYLIAGGGHAARRAAETLRERDPAARIVMIGAEPELPYDRPVLSKDALVGDEGER
RAFVRDAAWYRERDIALRLGVRVDAIERAEQRVCLSDGARVGYARLLIATGSRVRRFTGP
VDADVPVHYVRTVADARALRAALAPGKRVAVLGGGFIGLEVAASAVRLGCRVTLVDPAQR
LLQRGMPEIIGAFALALHTRHGVDVRLAALPERIRRGADGAAVIETSAGDVEADVVVAGI
GVVPNVELAQAAGLDVDNGVCVDEMCRTADPAIFAAGEVTQHFNPLVGRRVRIESWQVAE
NQPAVAAANMLGGGETYAEWPWLWSDQYDCNLQTLGLFGGEQTLVVRGAPDDGAFCVFAL
NARGELEAAAAVNAGREIAACRRLMTAHVVPDPAHLADPSVALRSMLPRSV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtcgacgagtgatccgtatctgatcgcgggcggcgggcatgcggcgcgccgcgcggcc
gagacgctgcgcgaacgcgatccggccgcgcggatcgtgatgatcggcgcggagcccgag
ctgccgtacgaccggccggtgctgtcgaaggacgcgctcgtcggcgacgaaggcgagcgc
cgcgcgttcgtgcgcgacgccgcgtggtatcgcgagcgcgacatcgcgctgcggctcggc
gtgcgcgtcgatgcgatcgagcgcgccgagcagcgggtgtgcttgagcgacggcgcgcgc
gtcggctacgcgcgtctgctgatcgcgaccggctcgcgcgtgcggcgcttcaccggcccg
gtcgacgcggacgtgccggtccattacgtgcgcaccgttgccgacgcccgcgcattgcgc
gcggcgctcgcgcccggcaagcgcgtcgcggtgctgggcggcggcttcatcgggctcgag
gtcgccgcgtcggcggtgcggctcggctgccgcgtgacgctcgtcgatcccgcgcaacgc
ctgcttcagcgcgggatgccggaaatcatcggcgcgttcgcgctcgcgctgcatacgcgg
cacggcgtcgacgtgcggctcgccgcgctgcccgagcggattcgacgcggcgcggacggc
gcggccgtcatcgagacgagcgcgggcgacgtcgaagccgacgtcgtcgtggccggcatc
ggcgtcgtgccgaacgtcgagctcgcgcaggcggcgggcctcgacgtcgacaacggcgta
tgcgtcgacgagatgtgccgcaccgccgatccggcgatcttcgcggcgggcgaggtcacg
cagcatttcaatccgctcgtcggccgccgcgtgcggatcgaatcgtggcaggtcgcggag
aaccagccggccgtcgcggcggcgaacatgctaggcggcggcgaaacctacgcggaatgg
ccgtggctatggtccgatcagtacgactgcaatttgcagacgctcggcctcttcggcggc
gagcagacgctcgtcgtgcgaggggcgccggatgacggcgcgttctgcgtgttcgcgctg
aatgcgcgcggcgagctcgaagcggccgcggcggtcaacgcggggcgcgagatcgccgcg
tgccggcggttgatgacggcgcacgtcgtgcccgatcccgcgcatctcgcggacccgtcc
gtcgcgttgcggtcgatgctgccgcgcagcgtttag

DBGET integrated database retrieval system