KEGG   Burkholderia oklahomensis E0147: DM82_6249Help
Entry
DM82_6249         CDS       T03284                                 

Definition
(GenBank) putative phosphofructokinase pfkB
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bok  Burkholderia oklahomensis E0147
Pathway
bok00010  Glycolysis / Gluconeogenesis
bok00030  Pentose phosphate pathway
bok00051  Fructose and mannose metabolism
bok00052  Galactose metabolism
bok00680  Methane metabolism
bok01100  Metabolic pathways
bok01110  Biosynthesis of secondary metabolites
bok01120  Microbial metabolism in diverse environments
bok01130  Biosynthesis of antibiotics
bok01200  Carbon metabolism
bok01230  Biosynthesis of amino acids
Module
bok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DM82_6249
   00030 Pentose phosphate pathway
    DM82_6249
   00051 Fructose and mannose metabolism
    DM82_6249
   00052 Galactose metabolism
    DM82_6249
  09102 Energy metabolism
   00680 Methane metabolism
    DM82_6249
Enzymes [BR:bok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DM82_6249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AIO68481
LinkDB All DBs
Position
2:complement(2945682..2946623)
Genome map
AA seq 313 aa AA seqDB search
MTEIVTITPNPAVDVATSVDRVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCAALYL
AGGDTGRALRGLLADERMRASGIDVADETRENFSVLETSTGREFRFVLPGPTLAPDEWPS
CIDALARLADASRFLVMSGSLPPGMPDDCYARLARLANARGVRTVVDTSGPALAAALDAG
VYLVKPSLGELRALTGLPLDDDAERLAAARAIVGSGRAQIVALTLGDAGALVVSRDDAVR
LPGARVAVRSAIGAGDSFVAGLVDALNRGASVADASRYALAAASASLLSAGTALCTKDDV
ERIYRELPGTVEA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatcgtcaccatcacgccgaatcccgcagtcgacgtcgcgacgtccgtcgac
cgcgtgaccgacacccgcaagctgcgctgcggacccgcgcggcgcgacccgggcggcggc
gggatcaacgtcgcgcgcgtgctgacgcgcctcggcgccgattgcgcggcgctctatctc
gcgggcggcgacaccggtcgcgcgctgcgcggcctgctcgccgacgagcgaatgcgcgcg
agcggcatcgacgtggccgacgagacgcgagaaaacttttcggtgcttgaaacgtcgacg
gggcgcgagttccgcttcgtgctgccggggccgacgctcgcgcccgacgaatggccgagc
tgcatcgacgcgctcgcgcggctcgccgacgcgtcgcgctttctggtgatgagcggcagc
ctgccgcccgggatgccggacgattgctacgcccgcctcgcgcggctcgcgaacgcgcgc
ggcgtgcggacggtcgtcgatacgtcggggccggcgctcgcggcggcgctcgacgcgggc
gtctatctggtcaagccgagcttgggcgagctgcgcgcgctgaccggcctgccgctcgac
gacgacgccgagcgcctcgcggccgcgcgcgcgatcgtcggcagcggacgcgcgcagatc
gtcgcgctgacgctcggcgacgccggcgcgctcgtcgtatcgcgcgacgacgcggtgcgg
ctgccgggcgcgcgcgtcgcggtgcgcagcgcgatcggcgcgggcgacagcttcgtcgcg
gggctcgtcgacgcgctcaatcgcggcgcgagcgtcgccgatgcgtcgcgttacgcgctc
gccgccgcgtcggcgtcgctgctgagcgcgggcaccgcgttgtgcacgaaggacgacgtc
gagcggatctatcgggaattgccggggacggtcgaggcctga

DBGET integrated database retrieval system