KEGG   Burkholderia oklahomensis E0147: DM82_982
Entry
DM82_982          CDS       T03284                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00311  electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
Organism
bok  Burkholderia oklahomensis E0147
Brite
KEGG Orthology (KO) [BR:bok00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM82_982
Enzymes [BR:bok01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.1  electron-transferring-flavoprotein dehydrogenase
     DM82_982
SSDB
Motif
Pfam: ETF_QO DAO FAD_binding_2 NAD_binding_8 FAD_binding_3 Pyr_redox_2 Thi4 HI0933_like Lycopene_cycl Pyr_redox_3 NAD_binding_9 Trp_halogenase Fer4_7 FAD_oxidored K_oxygenase GIDA
Other DBs
NCBI-ProteinID: AIO66815
UniProt: A0A381BN10
LinkDB
Position
1:complement(1136501..1138174)
AA seq 557 aa
MTPASLIEQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAGKGTEIGVCVLEKGSEIGA
HILSGAVMDPRAITELFPDWKAQGAPLTVDVTEDRFLFLTEKSGFQVPNWALPDNFKNHG
NYVISLGNVTRWLGQQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGIGKDGEPTEN
FQLGMELHAKYTLFCEGARGHLGRQLMDKFKLNANSDPQAYGIGIKELWEIDPVKHKPGL
VIHTAGWPLSSDTYGGSFLYHMDNNQVVVGFVVGLAYTNPYLSPFEEFQRYKTHPAIRPF
LEGGKRVSYGARAITAGGLLSLPKTVFPGGALVGDDAGFLNASRIKGSHAAIKTGMLAAE
AAFDAVQAGRQADELTAYPDAFKTSWLYTELYRARNFKQWMGKGLYLGTLMVGVEQKLMN
GNVPWTLHHQHADHEMLKPASQCQPIDYPKPDGKLTFDRLSSVFVSNTNHEENQPAHLTL
KDASVPVNVNLRTYAGPEARFCPAAVYEFVKSDDGTDRLVINAQNCVHCKTCDIKDPTQN
IVWVTPEGGGGPNYPNM
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgacccccgcaagcctcatcgagcaatacggcccgcgcgaatcgatggaatacgacgtc
gtgatcgtcggcggcggccccgcaggcctgtcggcggccatccgcctcaagcagctcgct
gccgggaaaggcacggaaatcggcgtctgcgtgctcgaaaagggttccgagatcggcgcg
cacatcctgtcgggcgccgtgatggacccgcgcgcgatcaccgaactgttccccgactgg
aaggcgcaaggcgcgccgctcaccgtcgacgtcaccgaagaccgcttcctgttcctgacc
gagaagagcgggttccaggtgccgaactgggcgctgccggacaacttcaagaaccacggc
aactacgtgatcagcctcggcaacgtcacgcgctggctcggccagcaggccgaggcgctc
ggcgtcgagatcttcccgggcttcccggcggccgagatcctctacaacgacgacggctcg
gtcaagggcgtcgcgacaggcaacatggggatcggcaaggacggcgagccgaccgagaac
ttccagctcggcatggagctgcacgcgaagtacacgctcttctgcgaaggcgcgcgcggc
cacctcggccgccagctgatggacaagttcaagctgaacgcgaacagcgatccgcaggcg
tacggcatcggcatcaaggagctgtgggaaatcgacccggtcaagcacaagccgggcctc
gtgatccacacggccggctggccgctgtcgtccgacacgtacggcggctcgttcctgtat
cacatggacaacaaccaggtcgtcgtcggcttcgtcgtcggcctcgcgtacacgaacccg
tacctgtcgccgttcgaagagttccagcgctacaagacccatccggcgatccggccgttc
ctcgaaggcggcaagcgcgtgtcgtacggcgcgcgcgcgatcacggcaggcggcctgctg
tcgctgccgaagaccgtgttcccgggcggcgcgctcgtcggcgacgacgcgggcttcctg
aacgcgtcgcggatcaagggcagccacgcggcgatcaagaccggcatgctcgccgccgaa
gccgcgttcgacgcggtgcaggcgggccgccaggccgacgagctgaccgcgtacccggac
gcgttcaagacatcgtggctctacaccgagctctatcgcgcgcgcaacttcaagcaatgg
atgggcaagggcctgtacctcggcacgctgatggtcggcgtcgagcaaaagctgatgaac
ggcaacgtgccgtggacgctgcatcaccagcacgcggaccacgaaatgctgaagcccgcg
tcgcagtgccagccgatcgactatccgaagccggacggcaagctgacgttcgaccggctg
tcgtcggtgttcgtctcgaacacgaatcacgaggagaaccagccggcgcacctgacgctg
aaggatgcgtccgtgccggtgaacgtgaacctgcgcacgtacgcggggccggaagcgcgc
ttctgcccggccgccgtctacgagttcgtgaagagcgacgacggtaccgatcgcctcgtg
atcaacgcgcagaactgcgtgcattgcaagacctgcgacatcaaggacccgacgcagaac
atcgtgtgggtcacgccggagggcggcggcgggccgaactatccgaacatgtga

DBGET integrated database retrieval system