KEGG   Brucella canis Oliveri: BCOUA_I1076Help
Entry
BCOUA_I1076       CDS       T03030                                 

Gene name
hisI
Definition
(GenBank) hisI
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bol  Brucella canis Oliveri
Pathway
bol00340  Histidine metabolism
bol01100  Metabolic pathways
bol01110  Biosynthesis of secondary metabolites
bol01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BCOUA_I1076 (hisI)
Enzymes [BR:bol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BCOUA_I1076 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: CDL76471
LinkDB All DBs
Position
I:1049134..1049493
Genome map
AA seq 119 aa AA seqDB search
MPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETGIAHYWSRSRKTLWKKGETSG
NLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYRQVVSSGGKVALTMVSDHDQ
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggtaagcgatcacgatcaataa

DBGET integrated database retrieval system