KEGG   Bos mutus (wild yak): 102264417
Entry
102264417         CDS       T02919                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin 13 receptor subunit alpha 2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102264417 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102264417 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102264417 (IL13RA2)
   04090 CD molecules [BR:bom04090]
    102264417 (IL13RA2)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL3 receptor family
   102264417 (IL13RA2)
CD molecules [BR:bom04090]
 Proteins
  102264417 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind DUF5345 TMEM107 DUF3844
Other DBs
NCBI-GeneID: 102264417
NCBI-ProteinID: XP_005903843
LinkDB
Position
Un
AA seq 380 aa
MAFIHLDTRCLYTLLICTAFGSTLSSNAEIKVNPPQDFQIVDPGYLGYLYLQWQPPVSLD
NFNKCTVEYELKYRNVDSESWRTIITKNLLYKDGFDLNKGVEAKIHTLLPRQCTNGSEVQ
SSWSEATYWISSQGNLDTKIQDMDCVYYNWQYLLCSWKPGMGAHLDSNYRLYYWYEGLDH
VLECIDYIQAKGKNIGCRFPYLESSDYKDFYICVNGSSESQLIRPSYFIFQLQNIVKPLP
PDYLSLTMKNSEVNLKWSIPRGPIPAKCLIYEIEFTEDDTAWVTTTIENEIYITRTSNES
LQLCFLVRSKMNIYCADDGIWSEWSDEQCWKGDIWKEILLFFLVPFVLVSLFVLIVTCTL
LYKQRNLLKMVFHTEKRSPF
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggctttcattcatttggataccagatgtctatatacccttcttatttgcacagctttt
ggctctactttgtcttcaaatgctgaaataaaagttaatcctcctcaggattttcaaata
gtggaccctggatatttaggttatctctatttgcagtggcaacctccagtgtctctggat
aattttaacaaatgcactgtagaatatgagttaaaatatcgaaatgttgatagtgaaagc
tggaggacgatcatcactaagaatctactttacaaagatggatttgatcttaacaaaggt
gttgaagcaaagatacacacacttctgccaaggcaatgcacaaatggatcagaagttcaa
agttcatggtcagaagctacttattggatatcatcacaaggaaatctggacactaaaatt
caggatatggattgtgtatattacaactggcaatatttactctgctcttggaaacctggc
atgggtgcccatttggatagcaattacaggttatactactggtatgagggcttggaccat
gtgttagagtgtattgattacatccaggctaaaggaaaaaatattggatgcaggtttccc
tacttggagtcatcagactataaagatttctacatctgtgttaatggatcatcagaatcc
cagttaatcagacccagctatttcatttttcagcttcaaaatatagttaaacctttgcca
ccagactaccttagtcttactatgaagaattcagaagtcaacctgaaatggagcattccc
agaggacctattccagcaaaatgtctcatttatgaaattgagttcacagaagatgatact
gcctgggtgactaccacaattgaaaatgaaatatacatcacaagaacatcaaatgaaagt
ctccaattatgctttttagtaagaagcaaaatgaatatttattgtgcagatgatggaata
tggagtgagtggagtgatgaacagtgctggaaaggtgacatatggaaggaaatcttacta
tttttcttggtaccgtttgttcttgtctcattatttgttttgatagttacttgtacactt
ttatataagcaaagaaatttattgaaaatggtttttcatactgaaaaaagaagccctttc
taa

KEGG   Bos mutus (wild yak): 102265298
Entry
102265298         CDS       T02919                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102265298 (EPOR)
   04151 PI3K-Akt signaling pathway
    102265298 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102265298 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102265298 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102265298 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102265298 (EPOR)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  Prolactin receptor family
   102265298 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 102265298
NCBI-ProteinID: XP_005890835
UniProt: L8ITR5
LinkDB
Position
Un
AA seq 508 aa
MYHLPAPLRAGIGFLCLLLAGAAWAPPPNPTDPKFENKAALLTAREPDEFLCFTERLEDL
VCFWEEAATAGVGPDNYSFSYQLEGEPWKPCRLHQAPTARGLVRFWCSLPTADTSSFVPL
ELHVTAASGASRYRRTIHVNEVVLLDPPARLVARRADEGGHVVLRWLPPPGAPMASLIRY
EVNISAENAAGSAQRVEILDGRTECLLSNLRGGTRYTFMVRARMAEPSFGGFWSAWSEPA
SLLTASDLDPLILTLSLVLVLILLLLAVLALLSHRRTLKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQTDGCLWWSPSTPLPEDPPAPLEVLSECCWGVTQAVEPGADDGGPLLEPVG
SEHAQDSYLVLDKWLLPRSPPSEDLLQPGGDMDIVTMDEASEASSCTSALALKPGPEGAS
ATSFEYTILDPSSQLLRPRALPPELLPTPPHLKYLYLVVSDSGISTDYSSGGSQEAQRGS
SNGPYSNPYENSLIPAPKPSPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtatcatctcccggcacccctccgggctggaattggcttcctctgcctcttgctcgct
ggggcagcctgggctcccccacccaatccaacggaccccaagtttgaaaacaaagcggcc
ctgctgacagcccgcgagcctgatgagtttctgtgcttcaccgagcgcttggaggatttg
gtgtgtttctgggaggaagcggccaccgccggagtcggcccggacaactacagcttctct
tatcagctcgagggtgagccgtggaagccatgccgcctgcatcaggcacccaccgcccgc
ggcttggtgcgtttctggtgctcgctgcctacagccgacacgtcgagcttcgtgccccta
gagctgcacgtcactgcggcctcgggcgcttcacgctaccgccgtaccattcacgtcaac
gaagtggtgctcctagaccctcccgccaggcttgtagctcggcgggccgacgagggcggc
cacgtggtactgcgctggctcccgccgcctggggcacccatggcgagccttatccgctat
gaggtgaatatctcggcagagaacgccgcagggagcgcacagagggtggagatcctcgac
ggccgcaccgagtgcttgctgagcaacctgcggggcggaacgcgctacaccttcatggta
cgcgcgcgtatggccgagcccagcttcggtggcttctggagcgcctggtccgagcctgcg
tcactgctgacggctagtgacttggaccccctcatcctgacgctctccctcgtcctcgtg
ctcattctgctgctgctggccgtgctggccctgctctcccaccgccggactctgaagcag
aagatctggcctggcatcccaagccctgagagcgagtttgaaggcctcttcacaacccac
aagggtaatttccagctgtggctgtaccagactgacgggtgtctgtggtggagccccagc
acccccctcccagaggacccacctgcccccctggaagtcctctctgagtgctgctggggg
gtgacacaggcagtggaacctggggcagatgacggggggcccctcctggagccagtgggc
agcgagcatgcccaagacagctacctggtactggacaagtggctgctgccccggagtccg
ccgagcgaggatctcctgcagcctggtggcgatatggacatagtgaccatggatgaagcc
tcagaagcgtcctcctgcacatccgctttggccctgaagcctgggccggagggggcctct
gctactagctttgagtacaccattcttgaccccagctcccagctcttgcgcccaagggca
ctgccccctgagctgctccccaccccaccccacctaaagtacctgtacctcgtggtgtcc
gactctggcatctcaactgactacagctcagggggttcccaggaagcccagaggggttca
tccaatggtccctactccaacccttatgagaacagcctcatcccagcccccaagccttca
cccccaagctacgtggcctgctcctag

KEGG   Bos mutus (wild yak): 102265420
Entry
102265420         CDS       T02919                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102265420 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102265420 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102265420 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102265420 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102265420 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102265420 (IL12RB2)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102265420 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind
Other DBs
NCBI-GeneID: 102265420
NCBI-ProteinID: XP_005895847
UniProt: L8III1
LinkDB
Position
Un
AA seq 861 aa
MAHTVGGCSLALIFIIMLLLVKAKIDVCKRGDVTVQPSHVISLGSAVNISCSLKPKQGCL
PSSSFNKLILYKFDRRIYVQHGHSLSSQVKGLPLGTTLFVCKLACSSSDEIRICGAEISV
GVVPEQPRNLSCVQKGERGTVTCTWHRGRDTHLYTAYTLQLNGPKNLTWQKQCNDHYCDH
LDLGINLTPESLESSYTVKVTAINSLGSASSFPFSFTLLDIVRPLPPWDIRIKFVNASVD
RCTLLWRDEGLVLLNRLRYRPINSRSWNMVNVTNAKGRHDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSESLRTQTPEEEPIGMLNVWYMRQHIDYNRQQISLFWKNLSLSEARGKILHY
QVTLQKVAGGEITLQNITEHTSWTWVIPRTGNWAAAVSAANSKGSSLPTRINITDLCGAE
LLAPQQVLAKSEGMDKLMVTWTPPEKATAAVQEYVVEWRELHPGAGMQPPLGWLWSPPYR
LSALISENIKPYICYEIRVHALAGDQGGCNSTRGNSQHKAPLSGPHINAISEEKGSVLIS
WDEIPAREQMGCILHYRIYWKERDSNSQPQLCEIPYRISPNSHPIDSLQPRVTYVLWMTA
LTAAGESPQGNEREFCLQGKANWSTFVAPSICMAVIMVGVLSMRCFRQKVFVLLLALRPQ
WCSKEIPDPANSTWAKKYPIVEEKTQLALDRLLTDWPTPEEPEPLVINEVLCRVTPVFRP
PHHRSWSEKGQGVRGHYTSEEDTGYSASSPPPPRAPTAETGQGVDLYKVLGSKGPDSKPG
NPASPLTILPVDYLPTHDGYLPSNMDYLPSHEAPITDPLEELPQHISLSIFPSSSLRPLT
FSCGEKLTLDQLKMGCGSLML
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcacatacagttggcgggtgctcactggcacttatttttatcatcatgttgctgtta
gttaaggcaaaaatagatgtgtgcaagagaggggatgtgactgtgcagccgtcccatgtc
atttcattaggatcagctgtcaacatttcctgctctttgaagcccaaacaaggctgcttg
ccatcctccagtttcaacaagttaatcctctacaagttcgacagaagaatttatgttcag
catggtcactccctcagttctcaagtcaaaggtcttcccctgggcacaaccctgtttgtc
tgcaagctggcctgcagcagcagtgacgagattcgaatatgtggggcagagatctccgtc
ggggttgttccagaacagcctcgaaacttatcttgtgtacagaagggagaacgtggaact
gtgacctgcacctggcacagagggcgagacacccacctgtacactgcatacactttacag
ttaaatggaccaaaaaatttaacttggcaaaagcaatgtaatgatcactattgtgatcat
ttggaccttggaatcaacctaacccctgaatcacttgaatctagttacacagtcaaggtt
actgctatcaatagtcttgggagtgcttcttcatttccattctcattcacattgctggac
atagtgaggcctcttcctccgtgggacatcagaatcaaatttgtaaatgcttccgtggac
aggtgtacccttctgtggagagatgagggactggtgctactcaatcgactcagatatcgg
cccattaacagcagatcctggaatatggttaatgtcacaaatgccaaaggaagacatgac
ttgctggatctgaaaccctttacagaatatgaatttcagatttcctctaagctacatctt
tataaaggtagttggagtgattggagtgaatctttgcgaacacaaacaccagaagaagag
cctattgggatgttaaatgtctggtacatgagacagcacattgactacaatagacaacag
atttctcttttctggaagaatctgagtctatcggaagcaagaggaaaaatcctccactat
caagtgaccttgcagaaggtggcaggaggggaaatcacactacagaacatcacagaacac
acttcctggacctgggtaattcccagaactgggaactgggctgcggctgtgtctgcagct
aactcgaaaggcagttccctgcccactcgcattaacataacggatctgtgtggggcagag
ttgctggctcctcaacaggtcttggcaaagtcagagggcatggacaagctcatggtgacg
tggacacctccagagaaagctaccgctgctgtgcaggaatatgtggtggagtggagggag
ctccacccaggggctggtatgcagccccctcttggctggttgtggagtcccccctacaga
ctgtctgctctgatttcagaaaacataaaaccttacatctgttatgaaatccgcgtgcat
gcacttgcaggggaccagggagggtgcaactccacccggggtaactcccagcacaaagca
ccactgagtggcccccacattaatgccatctcagaggaaaaggggagcgttttaatttca
tgggatgaaattccagcccgggagcaaatgggctgcatcctccactacaggatatattgg
aaggaacgggactccaactcccagcctcagctttgtgaaattccctataggatctcccca
aattcacatcccatagacagcctgcagcccagagtgacatatgttctgtggatgacagct
ctgacagctgctggtgaaagcccccaaggaaatgaaagagaattttgtctgcaaggcaaa
gccaattggagcacatttgtggcaccaagtatctgcatggctgtcatcatggtgggcgtt
ctctcaatgcgttgcttccgacaaaaggtatttgttctccttttggccctcagacctcag
tggtgtagcaaagaaattccagatccagcaaacagcacttgggccaagaaatatcctatt
gtggaggaaaagacacagctggccttggataggctcctgacagactggcccactcctgaa
gaacctgagccgctggttatcaacgaagtcctttgtcgagtgacaccagtcttcagacct
ccccatcaccgcagctggtcagaaaagggacaaggagtccgaggtcactatacctctgag
gaagacacagggtacagtgcctcaagcccaccacctccaagggctcccacagcagagaca
ggacaaggggtggatctatacaaggttctaggaagcaagggccctgactcaaagccgggg
aacccagccagccccttgaccatcctcccagtggactaccttcctacccatgatggctac
ttaccctccaacatggattatctcccttcacatgaggctcccataactgatcctctggaa
gaactgcctcaacacatctctctttccattttcccctcaagttcccttcgcccactcacc
ttctcctgtggtgagaagttgactctggaccagttaaagatggggtgtggctccctcatg
ctctga

KEGG   Bos mutus (wild yak): 102266368
Entry
102266368         CDS       T02919                                 

Gene name
IL23R
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102266368 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102266368 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102266368 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102266368 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102266368 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102266368 (IL23R)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102266368 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Lep_receptor_Ig IL12p40_C PriX
Other DBs
NCBI-GeneID: 102266368
NCBI-ProteinID: XP_005895850
LinkDB
Position
Un
AA seq 630 aa
MNQVTIHWDVVIALYIFFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PSKLYFYKNGIKERFHITRINKTTARLWYNNFVEPQAFVYCTAECSRYFPETLICGKDIS
SGYPPDVPDKVACVIYEYSGNMTCTWNPGRPTYIDTKYVVYVKSLETEEEQEYLTSSYIN
ISTDSLQKGKKYLVWVQASNVLGMEKSKQLQIHLDDIVIPSASIISRAEDINTTVSKTVI
HWDSQTSIEKVSCEMRYKDTTNQTWNVKEFDTNFTYEQQSEFYLQPNAMYVFQVRCQETG
KKYWQPWSSPFFHKTPEIVPQVTMKSFQHDTQNSGLLIASIFKKHLTSDNRKQDIGLLLG
MVFFAVMLSVLSLIGIFNRSLRTGIKRRILLLIPKWLYEDIPNMENSKVVKILQERNEFM
NNNSSEQVLYVDPVITEIEIILPEEKPMGYKKENNTGCLERKESLEKSLLTDTTVVYIPD
LNTGYKPQISSFLPGGNHLSNDDETASSILEPPADSLNLGNNARFKKYPDFAFSVSSTNS
LSNTLFLEELNLILNQGECSPPDMQNSIEGETAMLLEDALLNETIPEQTLLPDEFVSCLG
SMNKELPSINSYFPQNILESHFNRISLLEK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcattgggacgtggtaatagctctctacatattcttcagttgg
tgtcatggagggattacaaatataaactgctctggacacatctgggtagaacctgccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaagtaaactttatttttataaaaatggcatcaaagaaagatttcatatcacaagaatc
aataaaacaacagctcgcctttggtataacaactttgtggagccacaagcctttgtgtac
tgtactgctgaatgttccagatattttccagagacactgatatgtggaaaagacatttct
tctggatatccaccagatgtacctgacaaagtagcctgtgtcatttatgaatattctggc
aacatgacttgtacctggaaccctgggaggcccacctacatagacacaaagtatgtggtg
tacgtgaagagtttagagacagaagaagagcaagaatatctcacttcaagttacattaac
atctccactgattcattgcaaaagggcaagaagtatttggtttgggtccaagcttcaaat
gttctgggcatggagaagtcgaaacaactacaaattcatctggacgatatagtgatacct
tctgcatccattatttccagggctgaggatataaatactacagtgtccaagactgtaatc
cactgggatagtcaaacatcaattgaaaaagtttcctgtgaaatgagatacaaagataca
acaaaccaaacttggaacgttaaagaatttgataccaattttacatacgagcaacagtca
gaattctacttgcagccaaatgctatgtatgtatttcaagtgagatgtcaagaaacaggt
aaaaagtactggcagccctggagttcacccttttttcataaaactcctgaaatagttcct
caggtcacaatgaaatcattccaacatgatactcagaattctggacttctaattgcttcc
atctttaaaaaacaccttacttctgacaacaggaaacaagacattggacttttattggga
atggtcttctttgctgttatgctgtcagttctatctttgattgggatatttaacagatcg
cttcgaactggaattaaaagaagaatcttattgctaataccaaaatggctctatgaagat
attcctaatatggaaaacagtaaagttgtgaaaatacttcaggaaagaaatgagtttatg
aataacaattccagcgaacaggtcctatatgttgatccggtgattacagagatagaaatc
attctcccagaagaaaaacccatgggctacaagaaagaaaacaatacaggatgcctggag
agaaaagagagcctggagaaatcactactcaccgacactacagttgtttatattcctgat
ctcaacactgggtataaaccccagatttcaagttttctccctgggggaaaccatctcagc
aatgatgatgaaacagcttcctcaattctggaaccaccagctgattccttaaacttggga
aacaatgccaggtttaaaaaatatcctgattttgctttttctgtctcaagtacaaattca
ctaagcaacacactatttcttgaagaattaaacctcattttaaatcaaggagaatgcagt
cctccggacatgcaaaactcaatagagggggaaactgccatgcttctggaagatgcatta
ctgaatgaaactattccagaacaaactctgctgcctgatgaatttgtctcctgtttgggg
agcatgaacaaagagttgccatctattaattcttactttccacaaaatattttggaaagc
cacttcaatcggatttcactcttagaaaagtag

KEGG   Bos mutus (wild yak): 102266681
Entry
102266681         CDS       T02919                                 

Gene name
IL2RG
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04144  Endocytosis
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
bom05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102266681 (IL2RG)
   04151 PI3K-Akt signaling pathway
    102266681 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102266681 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102266681 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102266681 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102266681 (IL2RG)
   04659 Th17 cell differentiation
    102266681 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102266681 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102266681 (IL2RG)
   05340 Primary immunodeficiency
    102266681 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102266681 (IL2RG)
   05162 Measles
    102266681 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102266681 (IL2RG)
   04090 CD molecules [BR:bom04090]
    102266681 (IL2RG)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102266681 (IL2RG)
CD molecules [BR:bom04090]
 Proteins
  102266681 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 102266681
NCBI-ProteinID: XP_005900887
UniProt: L8I981
LinkDB
Position
Un
AA seq 379 aa
MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIGGKPGTGGDFFLTSTPAGTLDVST
LPLPKVQCFVFNVEYMNCTWNSSSEPQPNNLTLHYGYRNFNGDDKLQECGHYLFSEGITS
GCWFGKKEIRLYETFVVQLQDPREHRKQPKQMLKLQDLVIPWAPENLTLRNLSEFQLELS
WSNRYLDHCLEHLVQYRSDRDRSWTEQSVDHRHSFSLPSVDAQKLYTFRVRSRYNPLCGS
AQHWSDWSYPIHWGSNTSKENIENPENPSLFALEAVLIPLGSMGLIVSLICVYCWLERTM
PRIPTLKNLEDLVTEYQGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPPKGGEGPGGSP
CSQHSPYWAPPCYTLKPEP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgttgaagccaccgttgccactcagatccctcttatttctccagctacctctgctgggg
gtggggctgaacccaaagttcctcacgcccagtggcaatgaagacattggtgggaaacct
gggactggaggagacttcttcctgacttcaacacccgctgggacccttgatgtttctact
ctgcccctcccaaaggttcagtgttttgtgttcaatgtggagtatatgaattgcacttgg
aacagcagctctgagccccagcccaacaacctgactctgcattatgggtacaggaacttt
aatggtgatgataaactccaggagtgtggccactatctattctctgaaggaatcacttct
ggctgttggtttggaaaaaaggagatccgtctctacgaaacgtttgttgtccagctccag
gacccacgggaacaccggaagcagcccaaacagatgctaaaactgcaggatctggtaatc
ccctgggctccggagaacctgacgcttcgcaacctgagtgaattccagctagaactgagc
tggagcaacagatacttggaccactgtctggagcacctggtgcagtaccggagtgaccgg
gaccgaagctggacggaacaatccgtggaccacaggcatagcttctctctgcctagcgtg
gatgcacagaaactctacacgttccgtgttcggagccgttataacccactttgcggaagt
gctcagcattggagtgactggagctacccaattcactggggcagcaatacttcaaaagag
aatattgagaatccagaaaatccttccttgtttgcattggaagctgtgctgatccctctt
ggctccatgggattgattgtgagcctcatctgtgtgtactgctggctggaacggacaatg
ccccgaattcctactctcaagaacctagaggatctggttactgaataccaaggaaacttc
tcggcctggagtggtgtatctaagggactggccgagagtctgcagccagactacagtgaa
cggctctgccacgtcagtgagattccccccaaaggaggggaagggcctgggggctccccc
tgcagccagcacagcccctactgggctcctccatgttataccctgaaacctgagccctga

KEGG   Bos mutus (wild yak): 102268311
Entry
102268311         CDS       T02919                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102268311 (GHR)
   04151 PI3K-Akt signaling pathway
    102268311 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102268311 (GHR)
   04060 Cytokine-cytokine receptor interaction
    102268311 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102268311 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102268311 (GHR)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  Prolactin receptor family
   102268311 (GHR)
SSDB
Motif
Pfam: GHBP DUF5561 EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 102268311
NCBI-ProteinID: XP_005889783
LinkDB
Position
Un
AA seq 837 aa
MAAASSSVVRRVEELGDLAQAHIQQLSEAAGEDDHFLIRASAALEKLKLQCGEDKECSTP
SNLLELYTQAILDMTYFEENKLVDEDFPEDSSQKVKELINFLSEPEILVKENNMHPKHCD
LLGDELLECLSWRRGALLYMYCHSLTKRRDWLTRKSSLLKKYLVDGISYLLQMLNFRCPI
QLNEGASFQDLDTAKLLSEGPTGMDLWQLLLTLAVAGSSDAFSGSEATPAFLVRASQSLQ
ILYPVLETNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKEC
PDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLN
ISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLR
LDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIIFGILGLAVT
LFLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDS
WVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHV
SDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPASQQPSVILVEENKPRPLLI
GGTESTHQAVHTQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVV
TPCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGT
AEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggcggccgcaagctctagtgtggtgaggcgagtggaggaactcggagacctggctcag
gcccacatacaacaacttagcgaagccgccggcgaagatgatcactttttaattcgcgcc
tctgcagctctagaaaaattgaaacttcagtgtggagaagacaaagaatgttcaacccca
tcaaatcttctagaactttacacacaggctattttggacatgacatattttgaggagaac
aagctagtagatgaagattttcctgaagattcttcacagaaagtaaaagagttgatcaat
tttctttcagaaccagaaattttggttaaagaaaataatatgcatccaaaacactgtgat
ttgcttggagatgaactcctggaatgtctctcctggagacgaggagccctactctacatg
tattgtcattctctgaccaaaaggagagactggctcacaagaaaatctagcttacttaaa
aagtaccttgttgatggaatcagttacttactacaaatgctgaattttcgatgtcccatc
cagttaaatgaaggagcttctttccaagacctagacacagctaaattactaagtgaaggt
cctacaggtatggatctctggcagctgctgttgaccttggcagtggcaggctccagtgat
gctttttctgggagtgaagccacaccagctttccttgtcagagcatctcagagtctgcag
atactatatccagtcctagagacaaattcttctgggaatcctaaattcaccaagtgccgt
tcacctgaactggagactttctcatgtcactggacagatggggctaatcacagtttacag
agcccaggatctgtacagatgttctatatcagaagggacattcaagaatggaaagaatgc
cccgattacgtctctgctggtgaaaacagctgttactttaattcgtcttatacctccgtg
tggaccccctactgcatcaagctaactagcaatggcggtattgtggatcataagtgtttc
tctgttgaggacatagtacaaccagatccacccgttggcctcaactggactctactgaac
atcagtttgacggagattcatgccgacatcctagtgaaatgggaaccaccacccaataca
gatgttaagatgggatggataatcctggagtatgaactgcactataaagaactaaatgag
acccagtggaaaatgatggaccctttaatggtaacatcagttccgatgtactcgttgaga
ctggataaagagtatgaagtgcgtgtgagaaccagacaacgaaacactgaaaaatatggc
aagttcagtgaggtgctcctgataacatttcctcagatgaacccatctgcatgtgaagaa
gatttccagtttccatggttcttaattattatctttggaatacttgggctagcagtgaca
ttatttttactcatattttctaaacagcaaaggattaagatgctgattctacccccagtt
ccagttccaaagattaaaggaattgatccagatctcctcaaggaaggaaaattagaagag
gtgaatacaatcttagccattcatgacaactataaacacgaattctacaatgatgactct
tgggttgaatttattgaactagatattgatgaccctgatgaaaagactgaagggtcagac
acagacagacttctgagcaatgaccatgaaaaatcactcaatatctttggggcaaaggat
gacgactctgggcgtaccagctgctatgaacctgacattctggaggctgatttccatgtc
agtgacatgtgcgatggtacctcagaggttgctcagccacaaaggttaaaaggggaagca
gatatctcatgccttgatcagaagaatcaaaataattcaccttctaatgatgctgcccct
gctagccagcagcccagtgttatcctagtagaggaaaacaaaccaagaccacttctcatt
ggtggaactgagtcaactcatcaagctgtccatacacagctcagcaatccaagttcattg
gcaaacattgatttttatgcccaggtaagcgacattacaccagcaggaaatgtggtcctt
tccccaggccaaaagaataagactgggaacccccagtgtgacacgcacccagaagtggtc
acaccctgccaagctaacttcatcgtggacaacgcttacttctgcgaggtagacgccaaa
aagtacattgccctggcccctcacgtcgaggctgaatcacacgtagagccaagctttaac
caggaagacatttacatcaccacagaaagccttaccactacagctgggaggtcggggaca
gcagaacatgttccaagttctgagatacctgtcccagattatacctccattcatatagta
cagtctccacagggcctcgtactcaatgcgactgccctgcccttgcctgacaaagagttt
ctctcatcatgtggctatgtgagcacagaccaactgaacaaaatcatgccatag

KEGG   Bos mutus (wild yak): 102269313
Entry
102269313         CDS       T02919                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102269313 (PRLR)
   04151 PI3K-Akt signaling pathway
    102269313 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102269313 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    102269313 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102269313 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102269313 (PRLR)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  Prolactin receptor family
   102269313 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 102269313
NCBI-ProteinID: XP_005907433
UniProt: L8HXU9
LinkDB
Position
Un
AA seq 581 aa
MKENAASRVVFILLLFLNVSLLNGQSPPEKPKLVKCRSPGKETFTCWWEPGADGGLPTNY
TLTYHKEGETLIHECPDYKTGGPNSCYFSKKHTSIWKMYVITVNAINQMGISSSDPLYVD
VTYIVEPEPPANLTLELKHPEDRKPYLWIKWSPPTMTDVKSGWFIIQYEIRLKPEKATDW
ETHFTPKQTQLKIFNLYPGQKYLVQIRCKPDHGYWSEWSPESSIQIPNDFPVKDTSMWIF
VAILSAVICLIMVWAVALKGYSMVTCILPPVPGPKIKGFDVHLLEKGKSEELLRALESQD
FPPTSDCEDLLMEFIEVDDCEDQQLMPRPSKEHTEQGVKPMHLDLDSDSGRGSFDSPSLL
SEKCDEPQAHPSKFHTPEGPEKLENPETNLTCLQAPQSTSGEGKIPYFLANGPKSSTWPF
PQPPSLHSPRYSYHNIADVCELALGMAGTTATSLDQTDQHALKASKTIETGREGKATKQR
ESEGCSSKPDQDTVWPLPQDKTPLISAKPLEYVEIHKVSQDGVLALFPKQNEKFGAPEAS
KEYSKVSRVTDSNILVLVPDPQAQNLTLLEEPAKKAPPALP
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgcagcatctagagtggttttcattttgctactttttctcaacgtcagc
cttctgaatggacagtcacctcctgaaaaacccaagctcgttaaatgtcggtctcctgga
aaggaaacattcacctgctggtgggagcctggggcagatggaggacttcctaccaattac
acgctgacttaccacaaggaaggagaaacactcatccatgaatgtccagactacaaaacc
gggggccccaactcctgctactttagcaagaagcacacctccatatggaagatgtacgtc
atcacagtaaacgccatcaaccagatgggaatcagttcctcggatccactttatgtggac
gtgacttacatagttgaaccagagcctcctgcaaacctgactttggaattaaaacatcca
gaagatagaaaaccatatctatggataaaatggtctccacccaccatgactgatgtaaaa
tctggttggttcattatccagtatgaaattcgattaaaacctgagaaagcaactgattgg
gagactcattttactccgaagcagactcagcttaagattttcaacttatatccaggacaa
aaataccttgtgcagattcgctgcaagccagaccatggatactggagtgagtggagccca
gagagctccatccagatacctaatgacttcccagtgaaggacacaagcatgtggatcttt
gtggccatcctttctgctgtcatctgtttgattatggtctgggcagtggctttgaagggc
tatagcatggtgacctgcatcctcccaccagttccagggccaaaaataaaaggatttgat
gttcatctgctggagaagggcaagtccgaagaacttctgagagctctggaaagccaagac
ttccccccgacttctgactgcgaggacttgctgatggagttcatagaggtagatgactgt
gaggaccagcagctgatgccacgcccctccaaagaacacacggagcaaggcgtgaagccc
atgcacctggatcttgacagtgactctggccggggcagcttcgacagcccttcgctcttg
tctgaaaagtgtgatgaacctcaggcccatccctccaagttccatactcccgagggccct
gagaagctggagaatcccgaaacaaaccttacatgtctccaggcccctcagagcacaagc
ggggaaggcaaaatcccctattttctggccaatggacccaaatcttccacatggcctttc
ccgcagccccccagcctacacagccccagatattcttaccacaacattgctgacgtgtgt
gagctggccctgggcatggcaggcaccacagccacttcgctggaccaaacagaccaacat
gctttaaaagcctcaaaaaccattgaaactggcagggaaggaaaggcaaccaagcagagg
gagtcagaaggctgcagttccaagcctgaccaagacacggtgtggccactaccccaagac
aaaacccccttgatctctgctaaacccttggaatatgtggagatccacaaggtcagccaa
gatggagtgctggctctgttcccaaaacaaaacgagaagtttggcgcccctgaagccagc
aaggagtactcaaaggtgtcccgggtgacagatagcaacatcctggtgttggtgccggat
ccgcaagcgcaaaacctgactctgttagaagaaccagccaagaaggccccgccagccctg
ccatag

KEGG   Bos mutus (wild yak): 102269476
Entry
102269476         CDS       T02919                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04080  Neuroactive ligand-receptor interaction
bom04152  AMPK signaling pathway
bom04630  JAK-STAT signaling pathway
bom04920  Adipocytokine signaling pathway
bom04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102269476 (LEPR)
   04152 AMPK signaling pathway
    102269476 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102269476 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    102269476 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102269476 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102269476 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102269476 (LEPR)
   04090 CD molecules [BR:bom04090]
    102269476 (LEPR)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  Prolactin receptor family
   102269476 (LEPR)
CD molecules [BR:bom04090]
 Proteins
  102269476 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 102269476
NCBI-ProteinID: XP_005902372
LinkDB
Position
Un
AA seq 1165 aa
MICQKFCVALLHWEFIYVITAFNLAYPITPWKFKLSCMPSNTTYDFFFPPGISKNTSNLN
GRYEAVVETKLNSSGTYLSNLSSRTTFHCCFWSEEDKNCSVYTDDIEGKAFVTTVNSLVF
QQSGANWNIQCWMKEDLKLFICNIESLFKNPFKNYDLKVHLLYVLLDVLEESPLLPQKDS
FQVVQCNCSVHECCECHVPVPTAKLNNSLLMYLKITSGGAVFHSPPMSAQPINVVKPDPP
LGLRMEITDTGSLKISWSSPTLVPFQLQYQVQYSENSTKYIRKTDEIVSATSLLVDSVLP
GSSYGAQVRCKRLDGLGIWSDWSALLTFTTQDVIYFPPKILTAVGSNISFHCIYKNEKKI
VSSKKIVWWLNLAEKIPQSQYDVVDDHISKVTFPNLNATKPRGKFTYDAVYCCNEQECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSPNAIQSLAGSNLQLRYHRSSLYCSDVPSIH
PVSEPKDCHLQRDGFYECIFQPIFLLSGYTMWIRINHTLGSLDSPPACVIPDSVVKPLPP
SSVKAEITVKIGLLKISWEKPVFPENNLQFQIRYGLSGKQVQWKMFEVYDAKLKSASLPV
PDLCAVYTVQVRCKRLDGLGYWSNWSTPAHTVVMDVKVPIRGPEFWRLISEDTTKKERNV
TLLWKPLMKNDSLCSVRRYVVKHHTSHNGTWLEDVGNHTKLTFLWTEQAHSVMVLAINSI
GASSANFNLTFSRAISKVNIVQSLSAYPLNSSCVILSWMLSPSNYNLMYFILEWKILNED
SEIKWLRIPSSVKKYYVHDHFIPIEKYQFSLYPIFTEGVGKPKIINSFAQDDEKHQHDAD
LYVIVPIIISSSILLLGILSVSHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFIK
HTESTTFGPLLLEPETISEDISVDTSWKNKDEMVPATTDALLLTTPDLEKGSVCISDQCS
SAQFSEAESTDITCEDESRRQPSVKYATLLSNSKSGETEEEQGLINSSVSKCFLSNNSPP
KDSSSKRSWEIETQAFFILSDQHPNIISPHLPFSEGLDELLKLEGNFPEENNNERPVYYL
GVTSIKKRESDVFLTNESRVLSPFPAHCLFTDIRILQDSCSHLVENNFNLGTSGQKTFVS
YMPQFQTCSTQTQKIMENKMCDLTV
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggctttgttacattgggaatttatttatgtaataact
gcatttaacttggcatatccaattactccctggaaatttaagttgtcttgcatgccatca
aatacaacatatgacttcttctttcctcctggaatctcaaagaacacttcaaatttgaat
ggacgttatgaggcagttgttgaaactaagcttaattcaagtggtacctacttatctaac
ttatcatccagaacaactttccactgttgcttttggagcgaggaagataaaaactgctct
gtatatacagatgacattgaagggaaggcatttgttacaacagtaaattctttagttttt
cagcaatcaggtgcaaactggaacatacagtgctggatgaaagaggacttgaaattattc
atctgtaatattgagtcattatttaagaatcctttcaagaattatgaccttaaggtccat
cttttatatgttctgcttgacgtgttagaagagtcacctctgctcccccagaaagacagt
tttcaggttgttcagtgcaactgcagtgttcatgaatgttgtgaatgtcatgtgcctgtg
ccgacagccaagctcaataactcccttcttatgtatttgaaaatcacatctggtggagca
gtttttcactcacctccaatgtcagctcagcccattaatgttgtgaagcctgatccacca
ttaggtttgcgtatggaaatcacagacactggtagtttaaagatttcgtggtccagccca
acactggtaccatttcaacttcaatatcaagtgcaatattcagagaattctacaaaatat
ataagaaaaactgatgagattgtctcagctacgtctctgctagtagacagtgtgcttcct
gggtcttcgtatggcgcacaggtgaggtgcaagagattggatggcctaggaatctggagt
gattggagtgcccttcttacctttactacacaagatgtcatatattttccacctaaaatt
ctgacagcggttgggtctaacatttcttttcactgtatctataaaaatgaaaagaagatc
gtttcctcaaaaaagattgtttggtggttgaatttagctgagaaaattcctcaaagccag
tatgatgttgtggatgaccatattagcaaagttacttttcccaacttgaatgcaaccaaa
ccccgaggaaagttcacctatgatgcagtgtactgctgcaatgagcaagagtgccaccat
cgctatgctgagttatatgtgattgatgtcaatatcaatatatcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcacccaatgcaatccaatcacttgcaggaagc
aatttgcagctgaggtatcataggagcagcctgtactgttctgatgttccgtctattcat
cctgtatctgaacccaaagattgccacttgcagagagatggtttttatgaatgcatattt
cagccaatctttctattatctggctatacaatgtggattagaattaatcacacgttgggc
tcactggactctccaccagcttgtgtcattcctgattctgtggtgaaaccactgcctcca
tccagtgtgaaagcagagattactgtaaaaattggattattgaaaatatcttgggaaaag
cctgtctttccagagaataatcttcagttccagattcgctatggtttaagtggaaaacaa
gtacaatggaagatgtttgaggtatatgatgcaaaattaaaatctgccagtctcccagtg
ccagacctctgtgcagtctatactgtccaggtgcgctgtaagaggctagatggactggga
tattggagtaattggagtactccagcccacacagttgtcatggatgtgaaagttcctatc
agaggacctgaattttggagactaattagtgaagacaccactaaaaaagagagaaatgtc
actttgctttggaagcccctgatgaaaaatgactcattgtgcagtgtaagaagatatgtg
gtaaaacatcatacttcccacaatggaacgtggttggaagatgtgggaaaccacactaaa
ctcactttcctttggacagagcaagcacattctgttatggtgctggccatcaattcaatt
ggtgcttcttctgcaaattttaatttaacattctcacgggctatcagcaaagtaaatatc
gtgcagtcactcagtgcttaccctttaaacagcagttgtgtaattctttcctggatgctg
tcacccagcaattacaatctgatgtattttattcttgagtggaaaattcttaatgaagac
agtgaaattaaatggcttagaatcccttcctctgttaagaagtattatgtccatgatcat
tttatccccattgagaagtatcagttcagtctttatccaatatttacggaaggagtaggg
aaaccgaagataattaatagttttgctcaagatgatgaaaaacaccagcatgatgcagat
ctatatgtaatcgtgccaataataatttcctcctcaatcttattgcttggaatattgtca
gtatcacatcaaagaatgaaaaagttgttttgggaagatgttccaaaccccaagaactgt
tcctgggcacaaggacttaattttcagaagccagaaacatttgagcatctttttatcaag
catacagaatcaacgacctttggtcctcttcttttggagcctgaaaccatttcagaagat
atcagtgttgatacatcatggaaaaataaagatgagatggtgccagcaactacagatgct
ctacttttgacgactccagatcttgaaaagggttctgtttgtattagtgaccaatgcagc
agtgctcaattctctgaggctgagagcacagacataacctgtgaggatgagagcaggaga
cagccctctgttaaatatgccaccctgctcagcaactctaaatcaggtgaaactgaggag
gagcaaggacttataaatagctcagtcagcaaatgctttttgagcaacaattctccacca
aaggattcttcctctaagagatcatgggaaatagaaacccaggcattttttatattgtca
gatcagcatcccaatataatttcaccacaccttccgttctcagaaggcctggatgaactt
ttgaaacttgagggaaatttccctgaggaaaataataatgaaaggcctgtctattattta
ggagtcacttcaatcaaaaagagagagagtgatgtgtttttgaccaatgagtcaagagtg
ttgtccccattcccagcccactgtttattcactgacatcagaatcctccaggacagttgc
tcacaccttgtagaaaataacttcaacttaggaacttctggtcagaagacttttgtatct
tacatgcctcaatttcagacttgttccactcagactcagaaaataatggaaaacaagatg
tgtgacctaactgtttaa

KEGG   Bos mutus (wild yak): 102269868
Entry
102269868         CDS       T02919                                 

Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04072  Phospholipase D signaling pathway
bom04144  Endocytosis
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04520  Adherens junction
bom04540  Gap junction
bom04630  JAK-STAT signaling pathway
bom04810  Regulation of actin cytoskeleton
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102269868
   04012 ErbB signaling pathway
    102269868
   04014 Ras signaling pathway
    102269868
   04015 Rap1 signaling pathway
    102269868
   04630 JAK-STAT signaling pathway
    102269868
   04066 HIF-1 signaling pathway
    102269868
   04068 FoxO signaling pathway
    102269868
   04020 Calcium signaling pathway
    102269868
   04072 Phospholipase D signaling pathway
    102269868
   04151 PI3K-Akt signaling pathway
    102269868
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102269868
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102269868
   04520 Adherens junction
    102269868
   04540 Gap junction
    102269868
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102269868
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102269868
   04915 Estrogen signaling pathway
    102269868
   04921 Oxytocin signaling pathway
    102269868
   04926 Relaxin signaling pathway
    102269868
   04928 Parathyroid hormone synthesis, secretion and action
    102269868
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102269868
   05206 MicroRNAs in cancer
    102269868
   05205 Proteoglycans in cancer
    102269868
   05230 Central carbon metabolism in cancer
    102269868
   05231 Choline metabolism in cancer
    102269868
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102269868
  09162 Cancer: specific types
   05210 Colorectal cancer
    102269868
   05212 Pancreatic cancer
    102269868
   05225 Hepatocellular carcinoma
    102269868
   05226 Gastric cancer
    102269868
   05214 Glioma
    102269868
   05218 Melanoma
    102269868
   05219 Bladder cancer
    102269868
   05215 Prostate cancer
    102269868
   05213 Endometrial cancer
    102269868
   05224 Breast cancer
    102269868
   05223 Non-small cell lung cancer
    102269868
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102269868
  09172 Infectious disease: viral
   05160 Hepatitis C
    102269868
   05171 Coronavirus disease - COVID-19
    102269868
   05163 Human cytomegalovirus infection
    102269868
   05165 Human papillomavirus infection
    102269868
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102269868
   01522 Endocrine resistance
    102269868
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102269868
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102269868
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102269868
Protein kinases [BR:bom01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102269868
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102269868
  Exosomal proteins of pancreatic cancer cells
   102269868
  Exosomal proteins of bladder cancer cells
   102269868
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase GF_recep_IV APH Kinase-like Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 102269868
NCBI-ProteinID: XP_005907220
UniProt: L8HVW7
LinkDB
Position
Un
AA seq 664 aa
EPREFVENSECVQCHPECLPQAMNVTCTGRGPGNCVKCAHYIDGPHCVKTCPAGVAGENG
TLIWKFADANHVCLLCHPNCTYGCEGPGLEGCPQKGPKIPSIATGIVGGLLLVVVLALSV
GLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGSGAFG
TVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTS
TVQLITQLMPFGCLLDYVREHKDNVGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVL
VKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTV
WELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFREL
ILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQQGFF
HSPATSRTPLLSSLSTSSNTPTVTCVDRNGSYPLKEDSFLQRYSSDPTGALIEDSMDDAF
LPVPEYVNQSVPKRPAGSVQNPVYHNQPLYPAPGRDPQYQNSLSNAVDNPEYLNTTHPAC
INGVLDGPALWAQKGSHQFSLDNPDYQQAFFPKEAKSNGIFKGPAAENAEYLRAAPAGSD
FTGA
NT seq 1996 nt   +upstreamnt  +downstreamnt
agagcccagagaattcgtggagaactccgagtgtgtgcagtgccatccagaatgcctgcc
ccaggccatgaacgtgacctgcactggacgcggaccaggcaactgtgtaaagtgcgccca
ctacattgatggccctcactgcgtcaagacctgccctgctggagtcgcgggagagaacgg
caccctgatctggaagtttgcagatgccaatcacgtgtgtctcctgtgccaccccaactg
cacctatggctgtgaagggccaggtctcgaaggctgtccacaaaaagggcccaagatccc
gtccattgccacgggcatcgtgggcggcctgctgctggtggtggtgctggccctgagcgt
cggcctcttcatgcgcaggcgccacatcgtgcgcaagcgcacactgcgccggctgctgca
ggagcgtgagctcgtggagcctctgacgcccagcggagaagctcccaaccaagctctctt
gaggatcctaaaggaaacagaattcaagaaggtcaaggtgctgggctcaggagcattcgg
caccgtgtacaagggactctggatcccagaaggcgagaaggttaaaattcctgtagctat
caaggaattaagagaagccacatctccaaaagccaacaaggaaattcttgatgaggccta
cgtgatggccagtgtggacaacccccatgtgtgccgcctcctgggcatctgcctgacctc
caccgtgcagctcatcacacagctcatgcccttcggctgcctgctggactacgtccgcga
gcacaaggacaacgtcggctcccagtacctgctcaactggtgtgtgcagatcgcaaaggg
catgaattacctggaagaccggcgcttggtgcatagggacctggcggccaggaacgtgct
ggtgaagacgccacagcacgtgaagatcacagacttcgggctggccaagctgctgggtgc
cgaggagaaggagtatcatgcagaaggaggcaaggtccctatcaaatggatggctttgga
atcaattttacaccgaatttatacccatcagagtgatgtctggagctatggagtcactgt
ttgggagttgatgacctttggatccaagccttacgatggaatccctgcgagtgagatctc
gactgtcctggagaaaggagagcgcctcccacagccacccatctgcaccatcgacgtcta
catgatcatggtcaagtgctggatgatagatgcagacagtcgcccaaagttccgtgagtt
gatccttgaattctccaagatggcccgagacccccagcgctaccttgtcatccaggggga
cgagagaatgcatttgccaagccctacggactccaacttctaccgcgccctgatggatga
ggaggacatggaggatgttgtggatgctgacgagtacctcgtcccccagcagggcttctt
ccacagccccgccacctcccggacacccctcctcagctcgctgagcacctccagcaacac
tcccactgtgacttgcgttgatagaaatgggagctaccctctcaaggaagacagcttcct
gcagcgctacagctcagaccccactggtgccctcatcgaggacagcatggacgacgcttt
cctcccagtacccgaatatgtaaaccaatctgttcccaaaagacccgcaggctctgtcca
gaaccctgtctatcacaatcagcctctatatccagctcctggcagagaccctcagtacca
aaattcactcagcaacgccgtggacaaccctgagtatctcaacaccacccatcctgcctg
tatcaatggtgtactcgacggccctgccctctgggctcagaagggcagtcaccagtttag
cctagacaaccctgactaccagcaggccttctttcccaaggaagccaagtcgaatggcat
ctttaaggggcctgcagctgaaaatgcagaatacctgcgggcagcaccagcaggcagtga
ctttactggggcctga

KEGG   Bos mutus (wild yak): 102270608
Entry
102270608         CDS       T02919                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04072  Phospholipase D signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04630  JAK-STAT signaling pathway
bom04810  Regulation of actin cytoskeleton
bom05165  Human papillomavirus infection
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102270608 (PDGFRB)
   04014 Ras signaling pathway
    102270608 (PDGFRB)
   04015 Rap1 signaling pathway
    102270608 (PDGFRB)
   04630 JAK-STAT signaling pathway
    102270608 (PDGFRB)
   04020 Calcium signaling pathway
    102270608 (PDGFRB)
   04072 Phospholipase D signaling pathway
    102270608 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    102270608 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102270608 (PDGFRB)
   04540 Gap junction
    102270608 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102270608 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102270608 (PDGFRB)
   05206 MicroRNAs in cancer
    102270608 (PDGFRB)
   05230 Central carbon metabolism in cancer
    102270608 (PDGFRB)
   05231 Choline metabolism in cancer
    102270608 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    102270608 (PDGFRB)
   05218 Melanoma
    102270608 (PDGFRB)
   05215 Prostate cancer
    102270608 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102270608 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102270608 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102270608 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bom04090]
    102270608 (PDGFRB)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102270608 (PDGFRB)
Protein kinases [BR:bom01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102270608 (PDGFRB)
CD molecules [BR:bom04090]
 Proteins
  102270608 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 102270608
NCBI-ProteinID: XP_005901115
LinkDB
Position
Un
AA seq 1103 aa
MWLPSAMQAVVLKGRVLLLPLLFLLGPQASWGLAIIPPGPELVLNLSSTFVLTCSGPAPV
VWERMSQKPPQEMTETQDGTFSSVLTLVNVTGLDTGEYFCGYKRSHGLEASERKRLYIFV
PDPSVGFLPVDPEELFIFLTEITETTIPCRVTDPRLVVMLHEKKVDVPLPIAYDPQRGFS
GTFEDKTYICKTTIGDREVDSDAYHVYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGN
EVVNFEWTYPRMESGRLVEPVTDFLFEMPHIRSILHIPSAELGDSGTYICNVSESVSDHR
DEKAINVTVVENGYVRLLGQLDPVQFAELHRSRTLQVVFEAYPPPTVMWFKDNRTLGDSS
AGEIVLSTRNVSETRYVSELTLVRVKVAEAGYYTMRAFHEDAEAQLSFQLQVNVPVRVLE
LSESHPANGEQTVRCRGRGMPQPHLTWSTCSDLKRCPRELPPTPLGNSSEEESQLETNVT
YWAEEQEFEVVSTLRLRHVDQPLSVRCTLHNLLGYDVQEVTVVPHSLPFKVVVISAILAL
VVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRCSDKRRPPSAELYSNALP
VGLPLPSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPS
APERTCRVTLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFNGLRSPLDSSSVLYTAVQPNEGDNDY
IIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQPASQVE
PEPKWPPDSSCPGPRAEAEDSFL
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgtggcttccgagcgccatgcaagctgttgtcctcaaaggccgggtgctattgctgccc
ctgctgtttctgctgggaccacaggcctcctggggcctggccatcatacccccggggcca
gaacttgtcctcaacctctccagcacctttgttctgacctgctcgggcccagctccagtg
gtgtgggaacggatgtcccagaaacccccacaggaaatgaccgagacccaggatggcaca
ttctccagcgtgctgacactggtcaacgtcactggactagacacaggagaatacttctgt
ggctacaaacgctcccatgggctggaggccagtgagcgaaaacggctctacatctttgta
ccagatccttctgtgggcttcctccctgtcgaccctgaggagctattcatctttctcacg
gaaataactgagaccacaattccatgccgagtgacggatccgaggctggtggtgatgctg
cacgagaagaaggtggatgtccccctgcccatagcctatgaccctcagcgtggcttctct
ggtacctttgaggacaagacctacatctgcaaaaccaccatcggggacagggaggtggat
tccgatgcctaccatgtctacagcctccaggtgtcatccatcaatgtctcagtgaatgca
gtgcagactgtggtccgccaaggggagaatatcaccatcatgtgcattgtgaccgggaat
gaggtggtcaacttcgagtggacatacccacgcatggagagtgggcgcctggtggagcca
gtgactgacttcctctttgaaatgccccacatacgttctatcctgcacatccccagtgct
gagctaggagactcagggacctacatctgcaatgtatcagaaagcgtgagcgaccatcgt
gatgaaaaggctatcaatgtcaccgtggtcgagaacggctatgtgcgcctgctgggacag
ctggaccctgtacaattcgccgagctccaccgcagccggacactgcaggtggtgtttgag
gcctacccgccacccactgtcatgtggttcaaagacaaccgaaccctgggtgactccagc
gccggcgagatcgtgctgtccacacgcaatgtgtctgagactcggtatgtgtcagagctg
acactggtgcgggtgaaggtggctgaggctggctactacaccatgcgggccttccatgag
gatgctgaagcccagctctccttccagctgcaggtcaatgtgcctgtccgtgtgctggag
ctgagcgagagccaccctgccaatggggagcagacagttcgttgtcgcggccggggcatg
ccccagccacacctcacctggtctacctgcagtgacctcaaaaggtgtccgcgggagctg
ccgcccacgccgctggggaacagttccgaggaggagagccagctagagacgaatgtgacg
tactgggcggaggagcaggagttcgaggtggtgagcacactgcgcctgcgccatgtggat
cagccgctgtccgtgcgctgcacgctgcacaacctgctgggctacgacgtgcaggaggtc
accgtggtgccacattccctgcccttcaaggtggtggtgatctcggccatcctggccttg
gtggtcctcacgatcatctccctcattatcctcatcatgctctggcagaagaagccacgc
tatgaaatccgatggaaagtgatcgaatctgtgagctctgatggccatgagtacatctat
gtggaccctatgcagctgccctacgactccacctgggagctgccacgggaccagcttgtg
cttggacgcaccctgggctctggggcctttgggcaggtggtggaggccacggctcacggc
ctgagccattctcaggctaccatgaaagtggctgtgaagatgctgaaatccacagcccgc
agcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccccac
ctgaacgtcgtcaacctgctgggcgcctgcactaaaggagggcccatctacatcattacc
gagtactgccgttatggcgacctggtggactacctgcaccgcaacaagcacaccttcctg
cagcgctgctcggacaagcgccgcccgcccagcgccgagctctacagcaacgccctgcct
gttgggctccctctgcctagccacgtgtcactgcctggggagagcgatggtggctacatg
gacatgagcaaggacgagtcggtggactatgtgcccatgctggacatgaaaggagatgtc
aaatacgcagacatcgagtcctcgaactacatggctccttatgataactacgtcccctct
gctcctgagaggacttgccgggtgactttgatcaacgagtccccagtgcttagctacacg
gatcttgtgggcttcagctaccaggtggccaatggcatggagttcctggcgtccaagaat
tgtgtccaccgagacctggcagccaggaacgtgctcatctgtgagggcaagctggtcaag
atctgcgactttggcctggctcgtgacatcatgcgggactcaaactacatctccaagggc
agcaccttcctgcctctgaagtggatggcccccgagagcatcttcaacagcctctacact
accctgagcgacgtgtggtccttcggcatcttgctctgggagatcttcacgctgggtggc
accccatacccagagctgcccatgaacgagcagttctacaacgccatcaagaggggctac
cgcatggcccagcctgcccacgcctctgacgagatctacgagatcatgcagaagtgctgg
gaagagaagttcgagatccggccccccttctctcagctggtgctgcttctcgagagactg
ctgggtgagggctacaaaaagaagtaccagcaggtggatgaggagtttctgaggagcgac
cacccagccatccttcggtcccaagcccgcttgcctggcttcaatggcctccgatctcct
ctggactccagctccgtcctctatactgctgtgcagcccaacgagggggacaatgactac
atcatccccctgcctgaccccaaacctgaggttgctgatgagggcccactggagggttcc
cccagccttgccagctccaccctgaatgaagtcaacacctcctccaccatctcctgtgac
agccctctggaaccccaagaggagccagagccagagccgcagcctgcctcccaggtggag
ccagagcccaagtggccgccggattccagctgccccgggcctcgggccgaggcggaggac
agcttcctgtag

KEGG   Bos mutus (wild yak): 102272060
Entry
102272060         CDS       T02919                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor alpha
  KO
K05058  leukemia inhibitory factor receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272060 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272060 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102272060 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102272060 (LIFR)
   04090 CD molecules [BR:bom04090]
    102272060 (LIFR)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102272060 (LIFR)
CD molecules [BR:bom04090]
 Proteins
  102272060 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 102272060
NCBI-ProteinID: XP_005909190
UniProt: L8HQG9
LinkDB
Position
Un
AA seq 1095 aa
MVDISLCVKRPSWLVDRKRMRMASNSQWLLLTAVLLYLTNQVNSQKKSTPHDLKCVTNNL
KVWDCSWRALFGAGRAASYEVCIEKRSRTCYLLEKNTTIPPLLPGHYEITVHPLYEFGSS
KSKFILNEKNISLIPETPEILNLSADFSTSTLHLKWNDKGSVFPHYSNVIWEIKVLHKKN
MEIVKLVTYSTTLNGRDTIHHWNWTSDMPLECAIHYVGIRCYIDDPQFSGHKEWSDWSLL
KNISLPPDSQTKVFPQDKVILAGSDITVCCVTQEKVLSAQIGSTHCPLIHLDGENVAIRI
RNISASASSGTNVVFSVEDNIFGTVVFAGYPPDIPQKLNCETYDLKEIICTWNTGRPTSL
EGPRSTSYTLFESFSGKYVRFNGDEVSANENYQLFFQILSNQEIHNFTLNAQNLLGQTES
TLLVNITEKVHPRIPTSLKAKDINSTAVILSWHLPGNFTKVKLLCQIEINKTNSEHELRN
VTMRGVESSNYLTTVDKLNPYTIYTFRIRCSTDPFWKWSKWSNEKQCLTTEAIPSKGPDI
WREWSSDGRNLIIYWKPLPINEAYGKILSYNVSYSSDEETKSLSEIPDTQHRAELQLDKN
DYIISVVAKNSAGSSPPSKIASMEIPNDDLKIEQALGMGNRILLTWNYDPNMTCDYVIKW
CNSSQSGPCLMDWKKVPPNSTETVIESDQFRPGVRYNFSVYGCRNQGYQLLRSVIGYVEE
LAPAVAPNFTVEDTSADSILVKWEEIPVEELRGFLRGYLFYFEKGERDTSKIMGLEPGRF
DTKVKNITDISQKTLRIADLQGKTSYHLVLRAYTGGGMGPERSMFVVTKENSEGLIIAIL
IPVAVAVIIGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGNSALKTLEMN
PCTPNNVEVLETRSVALKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPVIEEELANP
GAEGGGASQVIYIDVQSMYQPQAKPEGELDSDPVGGAGYKPQMHLPVTSTVDDLDADDDL
DKTAGYRPQANVNTWNLVSPDSPRSTDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKSSG
GGWSFTNFFQNKPND
NT seq 3288 nt   +upstreamnt  +downstreamnt
atggtggacatttctttatgtgtgaaacgaccatcctggctggtggaccgcaaaagaatg
aggatggcttcaaattcccagtggctcttattaacagctgtgcttctgtatttaacaaat
caagtaaacagccagaaaaaaagtactcctcatgatttgaagtgtgtaactaacaattta
aaagtgtgggactgttcttggagagcactttttggagcaggtcgtgctgcttcttatgaa
gtttgcattgaaaagcggtcccgtacttgttatctattggagaaaaatactacaatccca
cctcttttacctggtcattatgaaataacagtacacccattatatgagtttggaagttcc
aaaagtaaattcatactaaatgaaaaaaacatttccttaattccagaaactccagagatc
ttgaatttgtctgctgatttctcaacttctacgttacacctaaagtggaatgacaaaggt
tctgtttttccacattactcaaatgtcatctgggaaattaaagttctacataaaaagaat
atggaaattgtaaaattagtgacctacagcacaactctgaatggcagagatacaattcat
cattggaactggacttcagacatgcccttggagtgtgccattcactatgtggggattaga
tgctacattgacgatcctcagttctctggtcacaaagaatggagtgactggagcctactg
aagaacatctccttgcctcctgattctcagactaaggtttttcctcaagacaaagtgata
cttgcaggctcagatataacagtatgttgtgtgactcaagaaaaagtgttatcagcacag
attggcagtacacattgtccccttatccatcttgatggggaaaatgttgcaatcaggatt
cgcaatatttctgcttctgcaagtagtggaacaaatgtggttttctcagtagaagataac
atatttggaacagttgtttttgcgggatatccaccagacattcctcaaaaactgaactgt
gagacatatgatttaaaagaaatcatttgcacgtggaatacaggaagaccgacgtccttg
gagggcccacgcagtacaagttacactttatttgaaagtttttcaggaaaatatgttaga
tttaacggagatgaagtgtccgcaaatgaaaactaccagttattctttcaaatactttca
aatcaagaaatacacaattttacattgaatgctcaaaatcttctgggtcagacagaatca
acacttttagttaacataactgaaaaagttcatccccgtattcctacttcactcaaagcg
aaggatattaattcaacagctgtgatactttcctggcatttaccgggcaactttacaaaa
gttaaactgttatgtcaaattgaaattaataaaactaactcagagcatgaattgcggaat
gtcacaatgaggggggtagaaagttcaaattatcttactactgtggacaagttaaatcca
tataccatatatacttttcggattcgttgttctactgaccctttctggaaatggagcaaa
tggagcaatgaaaaacagtgtttaaccacagaagccattccttcaaagggaccagatatt
tggagggagtggagttctgatggaagaaatctaataatatattggaagcctttacccatt
aatgaagcttatggaaaaatactttcttataatgtatcatattcatcagatgaggaaaca
aaatccctttctgagattcctgatactcaacacagggcagaattacaacttgataaaaat
gactacatcatcagtgtggtggcaaaaaattctgccggctcatcaccaccttctaaaata
gctagtatggaaattcccaatgatgatctcaaaatagagcaggctcttggaatgggaaat
aggatcctcctcacttggaattacgaccccaacatgacctgcgactatgtaattaagtgg
tgtaactcatctcagtctggaccctgcctcatggactggaaaaaagtccctccaaacagt
actgaaactgtaatagaatctgatcagtttcgaccaggtgtaagatataatttttcggtg
tatgggtgcagaaatcaaggatatcaattattacgttctgtaattggatatgtagaagaa
ttggctccagctgttgctccaaattttactgttgaggatacatctgcagattctatatta
gtgaaatgggaagaaattcctgtggaagagcttagaggatttttaagaggatatttattt
tactttgaaaaaggagagagagacacatctaagataatgggtttggaaccaggtcgtttt
gacacaaaggttaagaatattactgacatatcccagaagacactgaggattgctgatctt
caaggtaaaacaagttaccacctggtcttgcgagcctacacaggtggagggatgggccca
gagaggagcatgtttgtggtgacaaaggaaaactctgagggtttgattattgccattctc
atcccagtggcagtggctgtcatcattggagtggtaacaagtatcctttgctatcggaaa
cgagaatggattaaagaaaccttctatcctgatattccaaatccagaaaattgtaaagct
ttacagtttcaaaagagtgtctgtgagggaaacagtgctcttaaaacattggaaatgaat
ccttgtaccccaaataatgtcgaggttctggaaactcggtcagtggctctcaaaatagaa
gatacagagataatttctccggtggctgagcgtccagaagatcgctctgacgcagaaccg
gagaaccatgtggttgtatcctattgcccacccgtcatcgaggaagagctagcgaacccg
ggagcagaaggcggcggggcctcacaagtcatctacattgatgtccagtccatgtaccag
cctcaggcgaaaccagagggggagctggacagtgaccctgtagggggagcaggctataag
ccgcagatgcacctccccgttacttccactgtagacgatctggatgcagatgatgactta
gataaaactgcaggttacagacctcaggcaaatgtaaacacttggaacttggtatctcca
gactcacctcggtccacagacagcaacagtgagattgtgtcttttggaagtccgtgctcc
attaactcccgacaatttttgattccgcctaaagatgaagattctcctaaatcaagtgga
ggcggatggtcctttacaaacttttttcagaacaaaccgaatgattaa

KEGG   Bos mutus (wild yak): 102273605
Entry
102273605         CDS       T02919                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102273605 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102273605 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102273605 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102273605 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102273605 (IL5RA)
   04090 CD molecules [BR:bom04090]
    102273605 (IL5RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL3 receptor family
   102273605 (IL5RA)
CD molecules [BR:bom04090]
 Proteins
  102273605 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Tissue_fac Il13Ra_Ig LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 102273605
NCBI-ProteinID: XP_005911557
LinkDB
Position
Un
AA seq 505 aa
MNQPAVRRKRPLTAPAPAFPKTKPVGQSQGPAIAAARPPAARNRTSPARLLTVPTAPSPS
RALPGSRRRDVTNARRLTANGKSRKGVVIIMAPELLILLGAAVILQADLLPDKKFLLLPP
VNFTIKAVNLAQVLLRWEPNPDQEQSNIQLGYHVKINAPQEEDYETRNTERNLITILHKG
FSASVRTVPWNDHSLQASSWVSAELKAPTGSPGTEIVNLTCTTNTKADNYTHLRPYQVSL
HCTWLVGKDAPDDTQYFLYYRYRSWIEECQEYSKDVLQRNVACWFPRTFINSKGRDYLAV
YVNGSSKEAAIKPFDQLFALHAIDRVNSPANVTAEIKGTCLSIHWEKPVSAFPSHCFDYE
VKIYNAKKGYFQTEKMTTNTLITIIDDVSKYYIQVRAAVSPVCRATGLWSEWSRPIYVGK
DDQKPWTEWFLIAVMMTICFILLIFSLICRICHVWTKLFPPVPGPKSNINDFFVIINNEK
TGSSETEVISYVEEAGFETLEDSVF
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaatcagcccgcagtcaggcggaagaggcctctcaccgccccggcacccgccttcccc
aagaccaagcccgtgggacagtcccagggtcctgccatcgctgccgctcgccccccagca
gcgcgcaaccgcacgtcccccgcacgccttctcaccgtccccacggctccgtcgccgtcg
cgtgcacttccgggcagcaggcgccgtgacgtcaccaatgcgcgccggctgaccgcaaat
gggaagtcacggaagggagttgtgatcatcatggcacctgaattactgattcttttgggg
gcggcagtaatactgcaagcagacttacttcctgataaaaaatttttacttctaccacca
gtcaatttcaccattaaagctgtcaatttagctcaagttcttttacgttgggaaccaaat
cctgatcaagaacaaagcaatatccagctaggatatcatgtgaaaataaatgctccacaa
gaagaagattacgaaaccaggaacactgagagaaacctcataaccatccttcacaaaggc
ttttcagcgagtgtgcggacagtgccctggaacgaccactccctacaagccagcagctgg
gtttctgcagaacttaaagccccaacagggtctcctggaacggagattgtgaatttaact
tgcaccacaaacacgaaagcagataattacacacacttacgaccataccaagtttctctt
cactgcacctggcttgttggcaaggatgcccctgatgatacacagtacttcctctactac
aggtatcgctcttggattgaagaatgtcaggaatacagcaaagacgtcctgcagagaaat
gttgcctgctggtttcccaggactttcatcaatagcaaagggcgagactaccttgcagta
tatgttaacggctctagcaaggaagctgcgatcaagccttttgatcagctctttgccctt
catgccattgatcgagtaaattctccagcgaacgtcacggcagagatcaaaggaacctgt
ctctctatccactgggaaaaaccagtttctgcttttccaagccactgcttcgattatgag
gtgaaaatttacaatgcaaagaaaggatattttcagacagaaaaaatgacaaccaataca
ctcatcaccataattgatgatgtttctaagtattacattcaagtgagagcagcagtgagc
cctgtgtgcagagcgacggggctctggagcgagtggagtcggcccatttacgtggggaag
gatgatcagaagccctggacagagtggtttcttattgcagttatgatgaccatctgcttc
atcttgttaattttctcactcatctgcagaatatgccacgtatggaccaagttgtttccg
cctgttccagggccgaagagtaatattaatgatttctttgtaatcatcaacaatgagaaa
actggttccagtgaaactgaagtcataagttatgtggaggaggctggatttgagaccctg
gaagactccgtgttttga

KEGG   Bos mutus (wild yak): 102273764
Entry
102273764         CDS       T02919                                 

Gene name
IL4R
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102273764 (IL4R)
   04151 PI3K-Akt signaling pathway
    102273764 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102273764 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102273764 (IL4R)
   04658 Th1 and Th2 cell differentiation
    102273764 (IL4R)
   04659 Th17 cell differentiation
    102273764 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102273764 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102273764 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102273764 (IL4R)
   04090 CD molecules [BR:bom04090]
    102273764 (IL4R)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102273764 (IL4R)
CD molecules [BR:bom04090]
 Proteins
  102273764 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3 IL2RB_N1
Other DBs
NCBI-GeneID: 102273764
NCBI-ProteinID: XP_005907672
UniProt: L8HXB4
LinkDB
Position
Un
AA seq 808 aa
MGRLLSVLLFPVSCLILLWVAGSGSMRVLQDPTCFSDYISNSTCEWEMAGPTNCRAELHL
SYQLNFYYSENHTCVPENRAGVGGTVCVCHMLIENPVRQDIYQLDLWAGKQLLWNSSFKP
SEHVKPPAPRNLTVHADISHTWLLTWNNPYPSDNLLYSELTYLVNISNENDPTDFRTYNV
TYMGPTLRVAASTLRSGASYSARVKAWAQSYNSSWSAWSPSTKWLNYYEETWEQRLQLGV
GISCVIVLAVCVSCYISIIKIKKEWWDQIPNPAHSPLVAVVIQDSQVSLWRKRSRGQEPA
KCPHWKTCLAKLLPCLLEHGMERDDDFSKAARNGPSQGSGKVAWCPVEVSKTILRPESIS
VVRCVELFEAQVEKEEEEVEEDKGSFCPSPENSGGLFQEGREDIAARLTESLFLHLLRDE
TGGFSPQGVESCLLPPLENANAQRPWAEFPRVGPQEASSEDKEQPLSPESSPPATPTQNP
AGLPLPEMPATISDNPAYRSFSTFLSQSSGPGELDSDPQLAKCLGEVDPNIPTTPEPEPE
TWEQILRQRVLQHRAAPGPASAPSSGYREFVQAVKEGGTRDSGPAGFGPSEEAGYKAFSS
LLASSDSCPATSGVDPSSGEGGYKPFQSLASGCPRTPSPTPVPLFTFGLDTDPPHSPQDS
EWPELEPAVKGDDGQKPLFAPVPVTDPLRDDLGNGIIYSALTCHLCGHLKQCHGQEEAGK
AQIVASPCCGCCCGDRSSPLLSPLKAPDSLPQGTPLAASLSAASLAPLGVSEEGKCPLFN
APSHAQSSGQAPAVTAMPSPGPTCMDAS
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggggcggcttctctctgtactcctgttcccagtgagctgcctgatcctgttatgggtg
gccggctctgggagcatgagggtccttcaggatcccacctgcttctcggactacatcagc
aactccacctgtgagtgggagatggccgggcccaccaactgcagagccgagctccacctg
tcctaccagctgaatttttactactctgaaaaccacacatgtgtccctgagaacagagca
ggtgtggggggcacggtgtgcgtatgccatatgctgatagagaacccagtcagacaagac
atctaccagctggacctgtgggcagggaagcagctactgtggaacagctccttcaagccc
agcgagcacgtgaaaccaccggcccccagaaacctcacggttcacgccgacatctcccac
acgtggctgctgacgtggaacaacccgtacccttctgataacctcctgtactccgagctc
acctacctggtcaacatctcaaatgaaaatgaccccacggatttcagaacctataacgtg
acctacatggggcccaccctgcgtgtcgcggccagcaccctgaggtctggagcttcctac
agcgcacgggtgaaggcctgggctcagagctacaacagcagctggagcgcgtggagcccc
agcaccaagtggcttaactactacgaggagacctgggagcagcgcctccagctgggcgtc
ggcatctcgtgcgtcatcgtcctggcggtgtgcgtgtcctgctacatcagcatcatcaag
attaagaaagaatggtgggaccaaattcccaacccagcccacagccccctcgtggctgtt
gtcatccaggattctcaggtgtcactgtggaggaagcggtctcgaggccaggaaccagcc
aaatgcccacactggaagacttgtcttgccaagctcctgccctgtttactggagcatggc
atggagagggatgacgacttctctaaggctgctagaaatgggccttcccagggttctggg
aaagtagcatggtgccccgtggaggtcagcaagacgatcctccggcctgagagcatcagt
gtggtgcggtgcgtggagctgtttgaggcccaagtggagaaggaagaagaggaagtggag
gaagataaagggagcttctgcccatcacctgagaacagcgggggcctcttccaggagggc
agagaggacattgcggcccggctgacagagagcctgttcctgcaccttctcagagatgag
actgggggctttagtccacaaggtgtggagtcctgccttcttccccctttagaaaatgca
aatgctcagaggccctgggccgaattcccaagggtggggccccaggaggcatcatctgag
gacaaggaacagcctctgagcccagagtcaagtcctccggccactccaacccagaaccca
gccggcctgcctctcccagagatgcccgccaccatctcagacaaccctgcttaccgcagc
ttcagcaccttcctgagccagtcctcgggccctggagagcttgactcagacccacagctg
gccaaatgcctgggggaagtggaccccaacatccccaccacccccgagccggaaccagag
acctgggaacagattctgcgtcagagggtgctccagcacagggcggcccccggccccgcc
tcggcccctagcagcggctaccgggaatttgtgcaggcggtgaaggagggtggcacccgg
gacagcgggccggccggcttcgggccctctgaagaggccggctacaaggccttctccagc
ttgcttgccagcagtgacagctgccctgcgacttctggggttgaccccagcagcggggaa
gggggctacaaacccttccagagccttgcttctggctgccccaggaccccttcccccact
cccgttcccctgttcactttcggcctggacacggacccccctcacagtcctcaggactca
gagtggcctgagttggagccagcagtcaagggagacgatggacagaaacccctcttcgcc
cccgtgccggtcacagaccctctcagggacgacctgggcaacggcatcatctactcagcc
ctcacctgccacctatgtggccacctgaagcagtgccacggccaggaggaagctggcaag
gcgcaaattgtggccagcccctgctgcggctgctgctgtggggacaggtcctcgcctctg
ctgagtccgctgaaagccccagactccctgccccaggggactccactggcagccagcctc
tctgcggcctccctagcacccttaggtgtctcagaggagggtaagtgccctctgttcaat
gcccccagccatgcccagagctcaggccaggctcctgcagtgactgccatgccctcccca
ggccccacgtgcatggacgcttcctag

KEGG   Bos mutus (wild yak): 102274052
Entry
102274052         CDS       T02919                                 

Gene name
IL21R
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274052 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102274052 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102274052 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    102274052 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102274052 (IL21R)
   04090 CD molecules [BR:bom04090]
    102274052 (IL21R)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102274052 (IL21R)
CD molecules [BR:bom04090]
 Proteins
  102274052 (IL21R)
SSDB
Motif
Pfam: EpoR_lig-bind IL4Ra_N
Other DBs
NCBI-GeneID: 102274052
NCBI-ProteinID: XP_005907673
UniProt: L8HUY7
LinkDB
Position
Un
AA seq 531 aa
MPCAWAATLLLLMLQGTWGCSNLVCYTDYIETITCILDTWARHPDSLTLTWHDTYGELED
EVTSCSLLRSTHNATHVEYTCHMNVFRLMADDFFNVSMTDPSGNYSQECGSFIVAASIKP
SPPFNVTVNFSGYYNVSWSSSSSFSPSDRVYALKDKLQYELRYRKVGEPWAQSPGRKLIS
EDSRSVFLLPLEFHSGSSYELQVRAGPQPGSTFQGTWSEWSDPVVFHTQPEERKGDLYLH
LVPIPLILVCLIFVFLGLKVPWRPWEKVWLQVSSPKPFFQPLYVGHSGDFKKWVGTPFTA
SSLELRPWSPGVHLALEMCSPCPPQGVVKGLVPTELPEPTDLVEADGVPEPGSWGPVPST
AGSLGSSVYSQEKDRLYGLVSIDTVTVVDAEGLCGWPCTCGDDGYPALNLDTGLEPGPDT
EDRLLSTGTTILSCGCVSAGGPMRPGSLLDRLRLSHEDEADWTPGPSDSEAGSPPVGLDM
NTFDSGFADSDCGSPVESDFSSPRDEEPPRSYLRQWVVMAPPPTPPGSQAS
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgccgtgtgcctgggctgcgactttgctcctgctaatgctccagggaacctggggctgc
tccaacctcgtctgctacactgattacatcgagactatcacctgcatcctggacacatgg
gccaggcaccccgactcgctcaccctcacctggcatgacacatatggagaactggaggat
gaagtcacctcctgcagcctcctccggtccacccacaacgccacccacgtggagtacacg
tgccacatgaatgtgttccgcctcatggctgacgacttcttcaatgtaagcatgacagac
ccatccggcaactactcccaggagtgtggcagctttatagtggctgcgagcatcaagcca
tctccccctttcaacgtgaccgtgaacttctccggatattataatgtctcttggagttcc
agttccagtttcagtcccagtgaccgtgtctatgcactgaaggacaaacttcagtatgag
ctgcggtacaggaaggttggagagccctgggctcagagtccagggagaaagctgatctca
gaggattccagaagcgtctttctcctccctttggagttccacagtgggtcaagctacgag
ctgcaggtgcgggcagggccccagcccggctccaccttccaggggacctggagtgaatgg
agtgacccagtcgtctttcacacccagccggaagagagaaagggagacctgtatcttcac
ctggttcccatcccgctcatcctggtctgcctcatctttgtcttcttgggcctgaaggtc
ccttggaggccgtgggaaaaggtatggttgcaggtgtccagcccaaagcccttcttccag
cccctgtacgtgggccacagcggagacttcaagaaatgggtgggcacacccttcactgcc
tccagcctggagctgaggccctggagcccaggggtgcacttggcccttgagatgtgcagc
ccatgcccaccgcagggtgtagtcaaggggctggtgcccacggagctgcctgagcccaca
gacctggtggaagctgacggagtgcctgagccgggctcctggggcccagtgccctccacc
gccggcagcttgggcagctcggtttacagccaggagaaggaccggctgtacggcctggta
tccatcgacacggtgactgtggtggacgcggaggggctgtgtggctggccctgcacctgt
ggggacgatggctaccctgccctgaacctggacactggcctggagcctggtccggacaca
gaggaccggctcctgagcacggggaccacgatcctgtcttgtggctgtgtctcggctggt
ggccccatgaggccgggcagcctccttgaccggctaaggctgtcccatgaggatgaggca
gattggacacctgggccgtcggacagcgaggcgggctcgcccccggtcggcctggacatg
aacacgtttgacagcggcttcgcggactctgactgtggcagccccgtggagagtgacttc
agcagccccagggacgaggaaccccccaggagctacctccgacagtgggtggtcatggcc
cctccacctacgccgccggggtcccaggccagctag

KEGG   Bos mutus (wild yak): 102274749
Entry
102274749         CDS       T02919                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin 13 receptor subunit alpha 1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274749 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102274749 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274749 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102274749 (IL13RA1)
   04090 CD molecules [BR:bom04090]
    102274749 (IL13RA1)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL3 receptor family
   102274749 (IL13RA1)
CD molecules [BR:bom04090]
 Proteins
  102274749 (IL13RA1)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2 Presenilin
Other DBs
NCBI-GeneID: 102274749
NCBI-ProteinID: XP_014339035
LinkDB
Position
Un
AA seq 263 aa
MKCTWLPGRNTSPDTNYTLYYWHNSLGKILQCENIYREGQHIACSFNLTKVKDSSFEQHS
VQVMVKDNAGKIRPSFNIVPLTSHVKPDPPHIKNLSFQNGDLYVQWTNPQNFQSKCLSYE
VEVNNSHAETHDIFYVEEAKCQNTEFEGNLEGTICFMVPGVLPDTLNTVRIRVKTNKLCY
EDDKLWSNWSQAMSIGQKANQTFYITTLLIIPVIVAAAVIVLLLYLKRLKIIIFPPIPDP
GKIFKEMFGDQNDDTLVSTDYMG
NT seq 788 nt   +upstreamnt  +downstreamnt
atgaaatgcacttggctccctggaaggaatacaagtcctgacactaactacactctatac
tactggcacaacagcctgggaaaaattcttcagtgtgaaaacatctacagagaaggccaa
cacattgcttgttcctttaatctgactaaggtgaaggattccagttttgaacagcacagc
gtccaagtaatggttaaggacaatgcaggaaaaatcagaccatccttcaatatagtgcct
ttaacttctcatgtgaaacctgatcctccacatattaaaaatctctccttccaaaatggt
gacttatatgtgcagtggacaaatccacagaattttcaaagcaaatgcttgtcttatgaa
gtagaagtcaataacagccacgctgagacacatgatattttctatgttgaagaggccaaa
tgtcagaatacagaatttgaaggaaacctagagggtacaatttgtttcatggttcctggt
gttcttcctgatactttgaacacagtcagaataagagtcaaaacaaataagttatgctat
gaagatgacaaactctggagtaattggagtcaagcgatgagtataggtcagaaggccaat
cagacattttacataaccacattactcatcattccagtcatcgttgcagccgcagtcatt
gtccttctgctgtatttgaaaaggctcaagatcattatattccctccaattcctgatcct
ggcaagatttttaaagaaatgtttggagaccagaatgatgataccctggtaagtactgac
tatatggg

KEGG   Bos mutus (wild yak): 102274768
Entry
102274768         CDS       T02919                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin 10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274768 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102274768 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102274768 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102274768 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102274768 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102274768 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102274768 (IL10RA)
   04090 CD molecules [BR:bom04090]
    102274768 (IL10RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL10/28 receptor family
   102274768 (IL10RA)
CD molecules [BR:bom04090]
 Proteins
  102274768 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102274768
NCBI-ProteinID: XP_005897223
LinkDB
Position
Un
AA seq 584 aa
MLSHQIVKLVALLSLLLGSRAHGKDLELPRPPSAWFEAEFFHHVLYWTPIPNQSESTYYE
VELLRYGVEPTSWKSIQRCSQMLMMSCDVTVETLDLYRSNGYRARVRAVDGSQRSNWTSP
NTRFSMDEVTLTVASVKLEVHNGNIVGAIQLPRPEVAPEGDTYENIFHNFREYQIEVRKA
PGHYESHGKVKNESFKLPIPRGVGEFCIRVKPSVGSRVNKEVWSKEECILLTSQYFTVTN
ISIFLTFVLLLYGALAFCLTFQLYVRRRGKLPAVLVFKKPSPFNLISQFSHPETQDTVHT
LDEEAFPKVTPELRNSDMHGSTDSGFGSAKPSLQTEEPQFLLPASDPQAGGTLEKGMPQE
LENSCGSAGSSNSADSGICLPDPRLCPGTEPSWEPQVGSDSRDREDSGIGLVQNSRGQPE
DAQGGSASGHVSPLGPEEPVEEDSVAGAFQGYLKQTQCPEEKAAQAGGLEEESSSTEDLD
PQFRTCLDTEAGWPLPALAKGYVQQDPPEMILAPLQTPEEQWDRPTEDWSFLGLTSCGDL
GTSDWSFAHDLAPLDCVPAPGGLLGSFDSDLVTLPLITSLQSNE
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgctgtcgcaccagatagtgaagctggtggcgctcctcagcctgctcctcggctctcgc
gcgcacggtaaggatctggaactgcccagacctccatctgcgtggtttgaagcagagttt
ttccaccacgtcctctactggacacccattccaaatcagtctgaaagtacctattatgaa
gtggaactcctgaggtatggagtagagcccacctcctggaagtccatccagaggtgtagc
cagatgctgatgatgtcctgtgatgtcactgtggagaccctggacctgtatcgcagcaat
ggttaccgggccagagtccgggcagtggacggaagccagcgttccaactggacctctcct
aacacccgcttctccatggatgaagtgactctgacggttgccagcgtgaagctcgaggtg
cacaacggtaacatcgttggggccatccagctccccaggcccgaggtggcccctgaaggc
gacacgtatgaaaacatcttccacaatttccgggagtaccagattgaggttcgcaaggca
ccaggacactatgagtcccatggcaaggtcaaaaacgaaagcttcaaactcccaatcccg
agaggggtgggagagttctgcatcagggtgaaaccgtctgtgggctcccgagtaaacaag
gaggtctggtccaaggaggagtgcatcctgctcacctcgcagtatttcacagtgaccaac
atcagcatctttctcaccttcgtcctgctgctctatggagccctggccttctgtctgacc
ttccagctgtatgtgcggcgccgggggaagctgcctgctgtcctggtcttcaagaagccc
agtcccttcaacctcatcagccagttttcccacccagagacccaagataccgtccacacc
ctggacgaggaggccttccccaaggtgactccggagctgaggaactcagacatgcacggc
agcaccgacagtggcttcggcagtgccaagccgtcactgcagaccgaggagccccagttc
ctcctccctgcctccgacccccaggccggggggactctggaaaaggggatgccccaggag
ttggagaacagctgtggtagtgcaggtagtagcaacagtgcagacagcgggatctgcttg
ccagatccccgcctgtgtcccggcacggagcccagctgggagccacaggtggggagcgac
agccgggaccgggaggacagtggcattggcctggtccagaactctaggggacagcctgag
gatgctcagggtggctcagcttcaggccatgtgagtcccctgggacctgaggagcctgtg
gaagaagactcagtggcaggggccttccagggctacctgaagcagacccagtgcccagag
gagaaggcagcccaggcaggcggcctggaagaagagtcttcctcaacagaggaccttgac
ccccaattcaggacgtgcctggatactgaggcgggctggcctctaccagccctggccaag
ggctatgtgcaacaggaccccccagaaatgattcttgctcctttgcagacccctgaagaa
cagtgggaccgaccaactgaggactggtcatttctgggcttgaccagctgtggcgacctt
ggcacatctgactggagctttgcccatgaccttgcccctctggattgtgtgccggccccg
ggcggtctcctgggcagttttgactcagacctggtcaccctgccactgatcaccagcctg
cagtcaaatgagtga

KEGG   Bos mutus (wild yak): 102274858
Entry
102274858         CDS       T02919                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04144  Endocytosis
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274858 (IL2RA)
   04151 PI3K-Akt signaling pathway
    102274858 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102274858 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102274858 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102274858 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102274858 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    102274858 (IL2RA)
   04659 Th17 cell differentiation
    102274858 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274858 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102274858 (IL2RA)
   05162 Measles
    102274858 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102274858 (IL2RA)
   04090 CD molecules [BR:bom04090]
    102274858 (IL2RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102274858 (IL2RA)
CD molecules [BR:bom04090]
 Proteins
  102274858 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 102274858
NCBI-ProteinID: XP_005895569
LinkDB
Position
Un
AA seq 286 aa
MEPSLLMWRFFVFIVVPGCVTEACHDDPPSLRNAMFKVFRYEVGTMINCDCKTGFRRVSA
VMRCVGDSSHSAWENRCFCNSTSPAKNPVKQVTPAPEEQREKKPTDAQNQTQPPEEADLP
GHCEEPPPWEHEREPLKRVYHFTLGQTVHYQCAQGFRALQTGPXXXXXXXXXXXAESTCM
MINGELRWTRPRLKCIREGEHGQASDDAEPQESTEAPPGSGTFLPTRMAGTTDFQKPTDE
IATLDTFIFTTEYQIAVAGCTLLLASILLLSCLTWQRKWKKNRRTI
NT seq 861 nt   +upstreamnt  +downstreamnt
atggagccaagcttgctgatgtggaggttcttcgtattcatcgtggtacctggctgcgtg
acagaggcttgtcatgatgaccctccgagtctcagaaacgccatgttcaaggtcttcagg
tacgaggtgggcaccatgataaactgcgactgcaagacaggcttccgcagagtgtcagcc
gtcatgcgctgcgtgggggactccagccactctgcctgggaaaacagatgcttctgcaac
agcacctcccctgctaagaacccagtaaaacaagtcactcctgcacccgaagaacagagg
gagaaaaaacccacagatgcgcagaaccaaacgcagcctccggaggaagctgaccttcca
ggtcactgtgaggaaccgccaccatgggaacacgaacgtgaacctttaaagagagtctac
catttcacgctggggcagacggttcattaccagtgcgcccagggattcagggccctacag
accggtcctnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntgctgaaagcacctgcatg
atgatcaacggggagctgaggtggaccaggcccaggctcaagtgcatacgtgaaggggag
cacggtcaggcttcagatgacgcagagcctcaggagagcacggaagctccccctgggagt
ggaactttcttaccaaccaggatggcagggaccacagatttccagaagcccacagatgag
attgcaacgctggatacgttcatatttaccactgagtaccagattgcagtggccggctgc
accctcctgctcgccagcatcctcctcctgagctgcctcacctggcagcggaaatggaag
aagaacagaaggacaatctag

KEGG   Bos mutus (wild yak): 102274942
Entry
102274942         CDS       T02919                                 

Gene name
CSF3R
Definition
(RefSeq) colony stimulating factor 3 receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274942 (CSF3R)
   04151 PI3K-Akt signaling pathway
    102274942 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102274942 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102274942 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274942 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102274942 (CSF3R)
   04090 CD molecules [BR:bom04090]
    102274942 (CSF3R)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  Prolactin receptor family
   102274942 (CSF3R)
CD molecules [BR:bom04090]
 Proteins
  102274942 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind ObR_Ig Tissue_fac
Other DBs
NCBI-GeneID: 102274942
NCBI-ProteinID: XP_005893328
LinkDB
Position
Un
AA seq 841 aa
MVGLGAWSLVGAALIILLLPRSLEQCGHILLSAPIVRLGDQVTASCFITRNCSHLGTDWR
VVWKLEPELHPRERRQHLPNGTLQSTITLPHLNHSRVLLSCCLHWGNSLQILDQAELQAG
YPPTAPYNLSCIMNLTTNSLICQWEPGPDTHLSTSFTLKSFKSQDKCQTQKDSIPDCVPE
VGQSHCSIPRKHLQLYQNMSIWVQARNALGTSASPKLCLAPMDVVKLEPPTLWALEPSPA
VVPPQPGCLRLRWETWRPSLYIEQKCELRHQPRLGEAGWDLVSALPARTSQYELCGLLPS
TAYTLQMRCTRWRLPGHWSEWSPSLELTTAQRAPIVRLDTWWRQRQLDPQTVTVQLFWKP
IALEEDSGQIQGYLVSWRPSDQAGAEPTLCDTTELNCTFQLPSEAREVVLKAYNTAGTSH
PTPVVFLESRGPPLGRLHTTARDPHSLWVGWEPPSPQPQGYVIEWGLSPPSPNGSPMTWR
MEHNGSIAGTLLQENIRPFQLYEITVTPLYQDTKGPSQHIYAYSQEMAPSHGPELHLRHI
GKTWAQLEWVPEAPELGKSPLTHYTIFWTNTQDQSFSTVLNASTHSFVLRGLEPSSLYHV
QLMAASQVWAANSTSLTLMTLTLEESELHILLGLFGLLVLLICLCGAAQFCCRPSRKYSL
WPSVPDPARSSLGSWVPTITAEDILQLPSLRDPGMPPITKITVLEEEEKKPGPWESNDSS
GPGSLSTLVQAYVLQGDPRVPSAQPQPQPGNSDQVLYVQVLGSPTGPGPGHYLRCDSTQP
LLEGLSPSPKSYENLWFQTSSPGTPEPLVPHPEDDSIFEPLLDFPLLQGLRVSGAEGLGG
F
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggtggggctgggagcctggagcctggtgggagctgctctgatcatcctcctgctcccc
agaagcctggagcagtgtgggcatatcctcctctcagcccccatcgtccgcctgggagat
caagtcacggcctcctgcttcatcacccggaactgcagccacctgggcaccgactggcga
gttgtatggaaactggaaccggagcttcatcccagggagaggcggcagcacctgccaaac
gggaccctgcagtccaccatcaccttgccccacctcaaccactctcgggtccttctctcc
tgctgcctgcactggggcaacagcctgcagatcctggaccaggctgagctacaggcgggc
taccctcccactgcaccctacaacctatcctgcatcatgaacctcacaaccaacagcctc
atctgtcagtgggagccaggccccgacacccacctgtccaccagcttcaccctgaagagc
ttcaagagccaggacaaatgccagacgcagaaggattccatccctgactgcgtgccggaa
gtcgggcagagccactgctccatcccccgcaaacacctgcagctgtaccagaacatgagc
atctgggtgcaggccaggaacgcgctggggaccagcgcttccccaaagctctgcctggct
cccatggacgttgtgaaactggagccccccacactgtgggccctggagcccagccctgcg
gtggtcccgcctcagccaggctgcctgaggctgcgctgggagacctggaggccaagtctg
tacatagaacagaagtgtgagctgcgccaccagcctcggcttggagaagccggctgggac
ctggtgagcgccctgcccgccaggacctcccagtatgagctctgcgggctcctcccatcc
acagcctacaccctgcaaatgcgctgcacccgctggcgcctgcccggccactggagcgaa
tggagccccagcctggagctgaccactgcacaacgggcccccatcgtcagactggacacg
tggtggcggcagaggcagctggacccccagacggtgactgtgcagctgttctggaagcca
atagccctggaagaagacagcggacagatccaaggttacctggtttcctggagaccctca
gaccaggctggggcagagccaaccctctgtgacaccacggagctgaactgtaccttccaa
ctgccttcagaagcccgggaggtggtccttaaggcctataacacagctgggacctcgcat
cccacccccgtggttttcttggaaagcagaggcccacccctgggcagactccacaccact
gctcgagaccctcatagcctctgggtgggctgggagccccccagtcctcaacctcagggc
tatgtgattgagtggggcctcagtccccccagccccaacggcagtcctatgacctggagg
atggagcataatggaagcattgcagggaccttgctgcaggagaacatcaggccctttcag
ctctacgagatcactgtgacccccctgtaccaggacaccaagggaccctcccagcatatc
tatgcctactcccaagagatggccccctcccatggcccagagttgcatctcaggcacatt
ggcaagacgtgggcccagctggagtgggtgcctgaggcccctgagctggggaagagcccc
cttacccactacaccatcttctggaccaacactcaggaccagtccttctccactgtcctg
aatgcctccacccacagctttgtcctccgtggcctggagccttctagcttgtaccatgtc
caactcatggccgccagccaggtgtgggccgccaacagcacaagcctcaccctgatgacc
ttgactctagaggagtctgagctgcacatcctcctgggcctgttcggcctcctggtcttg
ctcatctgcctctgtggggctgcccagttctgctgcagacccagcaggaagtattccctc
tggccgagtgtcccggacccagcccgcagcagcctgggttcctgggtgccaaccatcacg
gcagaggatatcttacagctgcccagccttcgggaccccggcatgccacccatcaccaag
atcacggtgctggaggaggaagagaagaagccagggccctgggagtccaatgacagctca
gggcccggtagcctctccacccttgtccaggcctatgtgctccagggagacccaagagtg
ccctccgctcagcctcagccccagcctggcaacagcgaccaggtgctttacgtgcaggtg
ctgggcagccccacgggcccagggcctgggcactacctccgctgcgactcaactcagccc
ctcttggagggcctctcccccagtcccaagtcctacgagaacctctggttccagaccagc
tctccggggaccccagagcccctagtcccacatccggaggacgacagtatctttgagcct
ctgcttgacttccctctactacaaggactccgggtcagtggggcggagggtcttgggggc
ttctag

KEGG   Bos mutus (wild yak): 102275218
Entry
102275218         CDS       T02919                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha and beta receptor subunit 2
  KO
K05131  interferon receptor 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05160  Hepatitis C
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275218 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    102275218 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275218 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102275218 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102275218 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    102275218 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    102275218 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275218 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275218 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102275218 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    102275218 (IFNAR2)
   05164 Influenza A
    102275218 (IFNAR2)
   05162 Measles
    102275218 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    102275218 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275218 (IFNAR2)
   05169 Epstein-Barr virus infection
    102275218 (IFNAR2)
   05165 Human papillomavirus infection
    102275218 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102275218 (IFNAR2)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IFN receptor family
   102275218 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Pox_A6 Uroplakin_II
Other DBs
NCBI-GeneID: 102275218
NCBI-ProteinID: XP_005893407
UniProt: L8IPU6
LinkDB
Position
Un
AA seq 530 aa
MLLSQNVSAIGPLNLYPMVHISLVFGISYVAPVLSDEHCTLKMRFRNFQSVLSWELKNHS
IVPTHYTLWYTIMSKREDMKVVKDCINVTRSFCDLTDVWVNTTDMYIPQVVGFRENAKLV
ICMGSFFLAPDKPLDPPEFEIVGFTNHISVNVKFQFDSPGILSEELQFYLAFIEEHAGNS
VKRHQPQITGNITKNFNYVIDKLIPNTNYCISVYFEPKDPRKINRSPLKCTLFRPRRESE
SSESATIGGIITLFLITAVFISTVMILKRIGYICLRNDFPKVLNFYKLSVWVFPELPPLE
KVATVEVIHVNRKKKVWNYNYDDENDIENEAAPHLNSGGYTKHGLTGKLCPTSTTSASLE
DCSLEDCSEPSAKEPYLPEPKGDAETPMAPGPGPWQSEGTSGGYQTRGTLWQDPTSEEDS
DSTEGSEGRIVFNVNLNSVCVRALEDDKDSEVTLMSPSCPEETVELEDLNETESSVLVAS
EEGTQLPFTNPSTECPRPQDAPSDKSDTSESDVDMGDGYIVRQVNLKKFN
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcttttgagccagaatgtgtcagcgattggaccactgaatttgtatcccatggtgcac
atcagcctcgtgtttggtatttcgtatgttgcgcctgttctttcagatgaacattgcact
ttaaagatgagattccgaaatttccagtcagtcttatcatgggaattaaaaaaccattca
attgtaccaactcactatacattatggtacacaatcatgagtaaacgagaagatatgaag
gtcgtcaaggactgtataaacgtcacaagatcgttttgtgacctcacagacgtgtgggta
aacacgacggacatgtacatcccccaggtggttggattcagagagaacgcaaagctggtc
atttgtatgggctctttcttcctggcgccagacaagcctttggacccaccagagtttgag
attgttggttttacaaaccacatcagtgtgaatgtgaaatttcaattcgacagtcccggg
atactaagtgaagaattacagttttacttagcatttattgaagagcatgcagggaacagt
gttaagaggcatcaaccccaaataactggaaacatcaccaaaaatttcaattatgtcatc
gacaagttaattccaaacacaaactactgtatatccgtttattttgagcctaaagatcca
agaaaaataaacagatctcccttaaaatgtaccctctttcgacccagacgagaatcagag
tcatcagaatctgctacaataggaggaataattactctgtttttaataactgctgtcttc
ataagcactgtaatgatactgaaacggattggctatatatgcttaagaaatgatttcccc
aaagttttgaatttttataaactgtcagtctgggtgtttcccgagctgcccccgttggaa
aaagtggctaccgtggaagtcattcacgtcaacaggaagaagaaagtgtggaattataat
tatgacgatgaaaatgacatcgaaaatgaggcagctccccacttaaattcaggtggttac
accaagcacggactaacgggcaagctgtgtccaacttccaccacttcagccagcttggag
gactgcagcttggaggactgtagtgagcccagtgctaaggagccgtatctgcctgagccc
aagggggacgccgagacccccatggcaccagggcccggcccctggcagtcggaaggcaca
agtgggggctaccagacgagagggactctgtggcaggaccccacttccgaggaggacagt
gactccacggaggggtctgagggcagaatcgtcttcaacgtgaatttgaactctgtgtgt
gtgagagcccttgaggatgacaaggactcagaagtcactctaatgtccccatcttgtcca
gaagagacagtcgagctggaggacctcaacgagacagaatcaagcgttttggtggccagt
gaagaagggacacagctgcccttcaccaacccctctacggagtgcccgaggccccaagat
gctccttctgataaaagtgacacttccgagtcagatgttgacatgggggatgggtatata
gtaagacaagtgaatctaaaaaaatttaattaa

KEGG   Bos mutus (wild yak): 102275508
Entry
102275508         CDS       T02919                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin 10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275508 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275508 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102275508 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102275508 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102275508 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102275508 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102275508 (IL10RB)
   04090 CD molecules [BR:bom04090]
    102275508 (IL10RB)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL10/28 receptor family
   102275508 (IL10RB)
CD molecules [BR:bom04090]
 Proteins
  102275508 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac IFNGR1 Adeno_E3_CR2 zf-MIZ
Other DBs
NCBI-GeneID: 102275508
NCBI-ProteinID: XP_005893408
LinkDB
Position
Un
AA seq 317 aa
MARSLRSWLGGCLLMSALGMVPPPENVRMNSVNFKNILRWESPAFPKGNLTFTAQYQSYR
KFQDTCTSILLTECDFSSLSKYGDHTLRVRAEFADESSEWINITFCPVDDTTIGPPRMQV
EALANSLHVRFFAPRIENEPEPWTMRNIYNSWTYHVQYWKNGSDEKFSISSQYDFEFLRN
LESQTTYCVQVRGFLSDRNKAGEWSEPVCEQTTIDETTPSWMVASVLAASVCAALLLLLG
CFFLLRCVYRKARHAFPPRNSLPQHLKEFMSHPHHSTLLLFSFPLSDENEVFDKLSVITE
VSESCKLNPGAGCGLTT
NT seq 954 nt   +upstreamnt  +downstreamnt
atggcgcgcagcctccggagctggctgggcggctgcctcctgatgtcagcattaggaatg
gttccacctcctgaaaatgtcagaatgaattcagttaatttcaagaatattctacgatgg
gagtcacctgcttttcccaaggggaatctgacgttcacagctcagtaccaaagttacagg
aaattccaagatacatgcacgagtattttgttgacggaatgcgatttctcaagtctttcc
aagtatggtgaccacaccttgagagtcagggctgaatttgctgatgagagttcagagtgg
ataaacatcaccttctgtcctgtggatgacaccactatcggacctcccagaatgcaagta
gaagcacttgctaattctttacatgtgcgtttctttgccccaagaatcgagaatgaacct
gaaccgtggaccatgaggaacatttataactcatggacttaccatgtgcaatattggaaa
aatggctctgatgaaaagttttcaatttctagtcagtatgacttcgagttcctccgaaat
cttgagtcacagacaacttattgtgttcaagttcgagggtttctttctgatcggaacaaa
gctggagaatggagtgagcctgtctgcgagcaaacaaccattgacgaaaccaccccgtcc
tggatggtggccagcgtcctggcagcctccgtgtgcgccgctctcctgctactgctcggc
tgcttcttcctgctgcggtgtgtttacaggaaggcaaggcacgccttccccccgaggaat
tctcttccgcagcacctgaaagagtttatgagccaccctcatcacagcactcttctctta
ttctccttcccactgtctgatgagaatgaagtctttgacaaactgagcgtcatcacagaa
gtgtctgaaagctgcaagctgaaccctggggccggctgcggtctcacgacctga

KEGG   Bos mutus (wild yak): 102275527
Entry
102275527         CDS       T02919                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04066  HIF-1 signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05164  Influenza A
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05200  Pathways in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275527 (IFNGR1)
   04066 HIF-1 signaling pathway
    102275527 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275527 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102275527 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102275527 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    102275527 (IFNGR1)
   04659 Th17 cell differentiation
    102275527 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275527 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275527 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102275527 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102275527 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102275527 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    102275527 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    102275527 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275527 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102275527 (IFNGR1)
   05140 Leishmaniasis
    102275527 (IFNGR1)
   05142 Chagas disease
    102275527 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102275527 (IFNGR1)
   04090 CD molecules [BR:bom04090]
    102275527 (IFNGR1)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IFN receptor family
   102275527 (IFNGR1)
CD molecules [BR:bom04090]
 Proteins
  102275527 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102275527
NCBI-ProteinID: XP_005899158
LinkDB
Position
Un
AA seq 466 aa
MALLFFLVPVLLTGSWVEMSAANPGLSSVPPPTNVTIQAYNLNTVIFWDYPVILQSPMFT
VQVMNYEDGKWIDACNTSDHSCNIFSVINDPSSSVWGRVKVRVGQEESVYAQSKEFILCK
EGKVGPPKLGIRKKENQIIVDIFHPLITVNGKEPEAMYDDENTCYTFTYSVFVSVNRSET
TDKMYTKEEDCNETQCFLNIPVSSLNSQYCVSAEGVSELWAVTTEKSDELCITFSDDNNT
EDPVWIPIVAALLLFLVFALVVVCCIIKKFYPIKREGTKLPKSLLSVVKNASSEAKFDSK
IISPITYQPIAVENEQLSPGTISSLHTEDNPGKVEHGDLSSEMEVVTIEENISDLAPCSP
LTPEREDSIHASSNQSESCSITLNAYHSRNGSDSGLAVSDNCSSSEFPPSNKTEVKTEGQ
DFITLRNTTTSFGYDKPHVLVDLLVDEGGKESLIGYRLTADSREFS
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggctctcctctttttcctcgtccctgtcttgctgaccggaagctgggttgagatgagc
gccgcgaatccaggactttcttcggtgccaccaccaaccaatgttacaatacaagcctac
aacttgaacacggttatattttgggactatcctgttatactacagagtcctatgtttacc
gtacaagtgatgaactatgaggacgggaaatggattgatgcctgcaatacctctgatcat
tcttgtaatatcttttctgtaattaatgatccatcaagttctgtctggggtagagttaaa
gtcagggttggacaagaagaatctgtctatgcacagtccaaagaatttattttatgcaaa
gaagggaaagttggaccacctaaactgggtatcagaaagaaggaaaaccaaatcattgtt
gatatatttcaccctttaattactgtaaatggaaaagagccagaagctatgtatgatgat
gaaaatacttgttatacattcacatacagtgtgtttgtgagcgtcaatagaagcgagact
acggataaaatgtacacgaaggaagaggattgtaacgagactcagtgcttcttaaatatt
cctgtgtcctcactgaattctcagtactgtgtttcagcagaaggagtctcagaattatgg
gctgttacaactgaaaagtctgatgaactttgtattaccttttctgatgataacaacaca
gaagatcctgtttggattcctattgttgctgctttacttctctttcttgtatttgctctg
gtagttgtatgttgtatcattaagaagttttatccaattaagcgagaaggcaccaagtta
cccaaatccttgctgtctgtggtaaaaaatgcctcttcagaggcaaaatttgattcaaaa
attatatcacccatcacctaccagccaattgccgtagaaaatgagcagctgtccccaggg
accatttcaagcctgcacactgaggacaatccaggaaaagtggaacacggagatctttct
agtgaaatggaagtggtgaccattgaagaaaatatttctgacttggccccatgtagtcct
ctgaccccagagagagaggattctatccacgcaagcagcaaccagtctgaatcctgcagc
atcactttgaatgcgtatcactccagaaatggctctgatagtggcctggcggtgtcagac
aactgctccagctcagaatttcccccaagtaataaaactgaagtaaagactgaaggacaa
gacttcataacgctgagaaacaccaccacctcctttggttatgataaaccgcatgtgtta
gtggatctgcttgtggatgaaggtggtaaagagtccttaattggttacagacttacagca
gactccagagagttttcatga

KEGG   Bos mutus (wild yak): 102275793
Entry
102275793         CDS       T02919                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275793 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    102275793 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275793 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102275793 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102275793 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    102275793 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    102275793 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275793 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275793 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102275793 (IFNAR1)
   05160 Hepatitis C
    102275793 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    102275793 (IFNAR1)
   05164 Influenza A
    102275793 (IFNAR1)
   05162 Measles
    102275793 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    102275793 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275793 (IFNAR1)
   05169 Epstein-Barr virus infection
    102275793 (IFNAR1)
   05165 Human papillomavirus infection
    102275793 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102275793 (IFNAR1)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IFN receptor family
   102275793 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 CHASE5
Other DBs
NCBI-GeneID: 102275793
NCBI-ProteinID: XP_005893409
LinkDB
Position
Un
AA seq 560 aa
MLALLGATTLMLVAGRWVLPAASGEANLKPENVEIHIIDDNFFLKWNSSSESVKNVTFSA
DYQILGTDNWKKLSGCQHITSTKCNFSSVELENVFEKIELRIRAEEGNNTSTWYEVEPFV
PFLEAQIGPPDVHLEAEDKAIILSISPPGTKDSIMWAMDRSSFRYSVVIWKNSSSLEERT
ETVYPEDKIYKLSPEITYCLKVKAELRLQSRVGCYSPVYCINTTERHKVPSPENIQINAD
NQIYVLKWDYPYENATFQAQWLRAFFKKIPGNHSDKWKQIPNCENVTSTHCVFPREVSSR
GIYYVRVRASNGNGTSFWSEEKEFNIEMKTIIFPPVISVKSVTDDSLHVSVGASEESENM
SVNQLYPLIYEVIFWENTSNAERKVLEKRTNFIFPDLKPLTVYCVKARALIENDRRNKGS
SFSDTVCEKTKPGNTSKTWLIVGTCTALFSIPVVIYVVSVFLRCVKYVFFPSSKPPSSVD
EYFSDQPLRNLLLSTSEEQTERCFIIENASVITEIEETDEIDEVHKKYSSQTSQDSGNYS
NEDENSGSKISEEFPQQDSV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgctcgctctcctgggcgcgacgaccctgatgctggtcgctgggagatgggtgctgccc
gccgcctcaggggaagcaaatctgaagcctgaaaatgtcgagatccacatcattgatgac
aattttttcctgaagtggaacagcagcagtgagtctgtcaagaatgtgactttttcagca
gattatcaaatactaggaacggataactggaagaaattgtctgggtgtcaacatattact
agtaccaaatgcaacttttcttcagtcgagcttgaaaatgtttttgaaaaaattgaattg
cgcataagagcagaagaaggaaacaacacttccacatggtatgaggttgagccatttgta
ccatttctagaagctcagattggtcccccagatgtgcatttagaagctgaagataaggca
ataatactgagtatctctccccctggaacaaaagatagtatcatgtgggctatggatcgt
tcaagctttaggtatagtgtcgttatctggaaaaactcttcaagtctagaagaaagaacg
gaaactgtttatcccgaagataaaatttataaactgtcaccagagattacttattgttta
aaagttaaagcagaactgcgtttacaaagtagagttggttgctatagtccagtgtattgt
ataaataccacagagagacataaagtaccttcaccagaaaatatacaaatcaatgctgac
aaccagatctatgttcttaagtgggattacccatatgaaaacgcaacttttcaagctcag
tggctccgtgccttttttaaaaagattcctgggaatcattcagacaaatggaaacaaata
ccgaactgtgaaaatgtcacaagtacccactgtgtctttcctcgagaggtttcctcaagg
ggaatttactatgtccgtgtacgagcatctaatggaaatggtacctctttttggtctgaa
gagaaggaatttaatattgaaatgaaaactatcatatttcctccagtcatcagcgtgaaa
tccgttactgatgattcactgcatgtcagtgttggtgcttcagaagagtctgaaaacatg
tctgtgaatcagctctacccgctaatttatgaagtaattttttgggaaaacacttcaaat
gctgagagaaaagttctagagaaaagaaccaattttatctttcctgacttgaaaccgctg
actgtgtattgtgtcaaagccagagcactcattgaaaatgacaggcggaataaagggagc
agttttagtgatactgtgtgtgagaaaacaaaaccaggaaatacttccaaaacctggctt
atagttggaacttgcactgcattgttttctattcctgtggtcatttatgttgtgagcgtc
ttcttgagatgtgtcaagtatgtgttcttcccatcaagtaaacctccttcctctgttgac
gagtatttctccgatcagccactaaggaatctactcctttccacttctgaggaacaaacg
gaaagatgttttataattgaaaatgcaagcgttattactgaaatagaagagactgatgaa
attgatgaagttcacaaaaagtacagttcccaaactagtcaagattcaggaaactattca
aacgaagatgaaaacagtggaagcaaaataagcgaagagtttccgcaacaggacagtgtg
tga

KEGG   Bos mutus (wild yak): 102275814
Entry
102275814         CDS       T02919                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin 20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275814 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275814 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102275814 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102275814 (IL20RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL10/28 receptor family
   102275814 (IL20RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 CRIM Apc13p
Other DBs
NCBI-GeneID: 102275814
NCBI-ProteinID: XP_005899159
LinkDB
Position
Un
AA seq 558 aa
MCAPGPSARAAARGAPAPGLPALLFLLLVAAPTGRAVPCVSGDLPKPTNVAFISINMKNI
LQWNPPEGLQGMEVSYTVQYFIYGQKKWLNKSECRNISRTYCDLSAETSDYEHQYYAKVK
AMWGTNCSKWAETGRFYPFLETQIGPPEVALTTDEKSISIVLTAPKKWKKNPEESSISMQ
QIYSNLKYNVSIYNTKSNRTWSQCVTNHTLVFSWLEPGTLYCVLVESFVPGPPRLTHPSE
RQCVSTLEDQTTALEVKIILWYVLPISVTVFIFSVMGYSMYRYIHVGKEKHPANLVLIYG
NEFDKRFFVPTEKIVINFITLNILEDSKTSSKDISVMEKSSEASDLNEPIEDQEPHWEDV
GAEHLGYVSHAVDIVCDFEKSSKGTSLTQQEPPSRTTPMDKTVIEYECDVRSSDISVGPR
GQEFNLQEEVSLQGKIFEQQAPLADLGPQTLLCSYTPQLRDLDHLRQGHVDTEEGPEEEP
STTLVDWDPQTGKLCIPSLPSFQHDPEGCGHPESEGLGEEGLLSRLYQDQAPDKAPEENE
AYLMQFMEEWGLYVQMED
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtgcgcccccggaccctcagcgagggcggcggccagaggagccccggcacccggcctc
ccggccctgctgttcctgctgctggtggccgcgccgacgggacgggcagttccctgtgtc
tctggtgatctgcctaaacctacaaatgtcgccttcatatccataaacatgaagaatatc
ctacagtggaaccccccagagggcttacaaggcatggaagttagttacactgtgcagtat
ttcatatatgggcaaaagaaatggctgaataaatctgaatgcagaaatatcagtaggacc
tactgtgacctctctgctgaaacttctgactatgaacatcaatattatgctaaagttaag
gccatgtggggaacaaattgttccaaatgggcagaaactggacgattctatcctttctta
gaaacacaaattggcccaccagaggttgctttgactactgatgagaaatccatttctatt
gttctgacggctccaaagaagtggaagaaaaatccagaagaaagctctatttccatgcaa
caaatatactctaatctgaagtataatgtgtctatatataatactaaatccaatagaacg
tggtcccagtgtgtgacaaaccacactctggtgttcagctggctggagccgggcactctg
tactgtgtactcgtggagtcctttgtcccaggccctcctcgcctcactcacccttctgag
aggcagtgtgtcagtactctagaagatcaaacaacagcattggaggttaaaatcatcctc
tggtatgttttgcccatatctgttactgtgtttattttctctgtgatgggctactccatg
tacagatatatccatgtcggcaaagagaaacacccagcaaatctggttttgatttatgga
aatgaatttgacaaaagattttttgtacctactgaaaaaattgtgatcaacttcatcacc
ctcaatattttggaggattctaaaacttcttccaaggatataagtgtaatggagaaaagc
agtgaggcatcagacctgaatgagcccatcgaggaccaggaaccccactgggaggatgtg
ggggcggaacacctgggctatgtgtcacatgcggtggacatcgtatgtgactttgagaaa
agctccaaagggacgtccttaacccagcaagagccacccagcagaacaacgcccatggat
aaaacagtcattgaatatgaatgtgatgtaagaagtagtgacatttctgtggggcctaga
ggacaggagttcaatttgcaggaggaggtgtcccttcaaggaaagatatttgaacaacag
gcacctttagcagacttgggtccacaaacactgctgtgttcatatacccctcagctcaga
gacttggaccacctgcggcaggggcatgtggacacagaggaggggccagaggaagagccg
tccaccacgctggttgattgggaccctcagactggcaagctgtgtataccttcattaccc
agctttcaacatgacccagagggatgtggccatcctgaatctgaggggctcggggaggag
ggcctcttatctagactctaccaggaccaggctccagacaaggcaccagaagaaaatgaa
gcgtatctcatgcaatttatggaagaatggggattatatgtgcaaatggaagactaa

KEGG   Bos mutus (wild yak): 102276746
Entry
102276746         CDS       T02919                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04672  Intestinal immune network for IgA production
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102276746 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102276746 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102276746 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102276746 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102276746 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102276746 (IL15RA)
   04090 CD molecules [BR:bom04090]
    102276746 (IL15RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102276746 (IL15RA)
CD molecules [BR:bom04090]
 Proteins
  102276746 (IL15RA)
SSDB
Motif
Pfam: Sushi DUF1180 Cadherin_C_2
Other DBs
NCBI-GeneID: 102276746
NCBI-ProteinID: XP_014333627
LinkDB
Position
Un
AA seq 333 aa
MIRNWNPWMKLNLRTTRRIRMFGKGFRGPPSQQDVAEGVQEVVTLRGSLGFKVTDFHTSI
LQSKLQSAHIFSLFYASVGITCPTPTSVEHADIQVKSYSINSRERYVCNSGFKRKAGTSS
LTQCVFNETAKVAHWTTPNLKCIRDPSLSHQRPPSTAAPTGLTPEPESPTPSGKEPDLTS
KSDTKVATRPATGPGSRLPSTAPPVGTTGVVSKETTYIPAQTAAKAPEHTYPALQDTPGA
YQNNPRVVTAVSTVTVLFVVCLVFLLGRCLWSRRAHQTPGVEMESMESVPMTTGADARGE
DTEIHPHGLGGSGDAEASSGRSEGPALPQSERT
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgattcgaaattggaatccgtggatgaagctgaacttgaggactacaaggcgaataaga
atgtttgggaagggattcagaggccctcctagccagcaggatgtggcagaaggggttcag
gaggtggtgaccctgagagggtcccttgggtttaaagttactgacttccacacaagcatc
ctgcagagcaagctgcaatctgctcacattttctctctcttctacgcttctgtaggcatc
acctgcccgactcccacatccgtggagcatgcagacatccaggtcaagagttacagcatc
aactccagggagcggtatgtttgtaattctggcttcaagcgtaaagctgggacctccagc
ttgacccaatgtgtgtttaacgagaccgcgaaagtcgcccactggaccactcccaacctc
aagtgcatcagagacccctccctgagtcaccaaaggccaccctccacagcagcgcctaca
gggttgaccccagagccagagagccccaccccctccggaaaagagccagatcttacttcc
aagtcagacaccaaagtggccacaaggccagctactggaccaggctccaggctgccatcc
acagctcctcctgtgggaaccacaggggtagtcagtaaggagaccacctacatcccagct
cagacagcagccaaggctccggaacacacatacccggccttgcaggacacgcccggtgca
tatcagaacaatcccagagttgtgaccgccgtctcaactgtcaccgtgctctttgtagta
tgcctggtgtttcttctgggacgttgcctgtggtcaaggcgagcccaccagacacccggt
gttgagatggagagcatggagagtgtgccaatgaccacgggggccgatgccagaggggag
gacacggaaatccacccgcatggcctaggaggctccggggacgctgaggccagcagcggc
cgcagtgaaggcccagctcttccccagtcagagaggacctag

KEGG   Bos mutus (wild yak): 102277729
Entry
102277729         CDS       T02919                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102277729 (OSMR)
   04151 PI3K-Akt signaling pathway
    102277729 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102277729 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102277729 (OSMR)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102277729 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 102277729
NCBI-ProteinID: XP_005907684
LinkDB
Position
Un
AA seq 973 aa
MALFAVLQTTFLLALLPLRTYQSEVLSEPLPLTPESLNVSINSTKQCLHLQWTVHNPDYH
QEFKMVFQIQISRFKASNVIWLENYSTTVKRNQVLHWSWESELPLECAIHFVRMRTMVDD
ARIPAPRLWSNWSSWEKADAQNSLGDHPLYVFPKDKLVEEGSNVTVCYISRNHQDNISCY
LEDVLIYGRQLDQNVWAFEFKNVSFIRKTGTNFYCKGQGDPEGVVLLVSKVLEEPRDFSC
ETQDLKTLTCTWDPGNDTGLIQLPSYTLFESFSGKKTLCKHRNRCDWQVTQDSQEMYNFT
LVAENYFRKRSVSILFNLIHGVHPMAPYSLFPKSVSATNATVTWKVYSIGSSSALLCQLQ
LLGEGKVIQQHNISVRVNGEYLLSELKPDTEYMARVRCAYADHFWKWSELISQNFTTAEA
APSEAPDVWRDVTFVSGHPTVTLFWKPLSKVHANGKILFYNVVVENLDEPSSLKVLSVPA
PANSTKVTLNQSSYQIYVTAHNSVGPSPASAVAISGHPGNENVEEGRMNGTEDGFPMSWK
PQSRNATGYVVEWCDSPQHLPCVLRWKNLGPTNTDTVISSGAFRPGVRYNFRIYEISTKR
MAHLLEKKAGYLKELAPSYNPKVNMSNLTSHSFTLSWKDYPTESQTGFIQGYYVYLKSKT
GEKCHRGFEKTFLTDNSVCCKYTIDNPDQKTFVVKDLQPESAYEFLVTPYTSAGEGPLDD
FRKVTTPDEYSHILIHIILPMVFFVFVIMIICYLKSQWLKDKCYPDIPDPYKSSVLSLIK
FKENPHITIMNVNDCVPDAIEVVNKPEGSKIQFVGTRKSPTETKGTKPAYLDLLPTEKNY
SGPGPCICFENFTYNQAASDLGYCGHFPVTPQAPHCQLGPLTSPENLLKTLEQNYMNSLG
EIPAGEANLNYVSQLASPMSGDRESPPTNPPEPALCSEYKMQMAIPLGLASPARSENSSL
SSTALLDPHEHCH
NT seq 2922 nt   +upstreamnt  +downstreamnt
atggctctctttgcagtcttgcagacaacattcctcttggcattgctgcccttgagaact
taccaaagtgaagttctgtctgaacctttaccattaactcctgaatcactgaacgtttcc
atcaattctacaaagcagtgtttgcatttacaatggactgtccacaaccctgattatcac
caggaattcaaaatggtttttcagatacagatcagtagatttaaagcatccaatgtcatc
tggttggagaactacagcaccactgtgaagcggaaccaagtcctgcactggagctgggaa
tctgagctccctttggaatgtgccatccactttgtaagaatgaggactatggtggatgat
gccaggattcctgcacccaggctctggagtaactggagttcatgggagaaagcagatgcc
cagaattcacttggagatcatccattgtacgttttccctaaagataagctggtggaagag
ggctccaatgtcaccgtttgttacatttctaggaaccatcaagataacatatcctgttat
ttggaagatgtactgatatatggaagacaacttgatcaaaatgtatgggcattcgagttc
aagaacgtttctttcattaggaaaactggaaccaatttctattgtaagggccaaggtgat
ccagagggcgtcgttcttttggtctcaaaagtgcttgaagagcccagggacttttcttgc
gaaacccaggacctgaagactttgacctgtacttgggatcccgggaatgacactggcttg
attcaactgccttcctacactttatttgaatcattttccgggaaaaagacactttgtaaa
cacagaaaccggtgtgattggcaagtaactcaagactcacaagaaatgtataactttaca
ctcgtggctgaaaactactttagaaaaagaagtgtcagtattctttttaacctgattcat
ggagttcatccaatggctccctatagcttgttccctaaaagtgtcagtgctacaaatgcc
accgtgacctggaaggtatactccataggaagcagttctgcacttttgtgtcagcttcaa
ctccttggtgaaggaaaagtgatacaacaacacaatatctccgtcagggtgaatggtgag
tacctcttaagtgaactgaagccggacacagaatatatggcccgtgtacgctgtgcttat
gccgaccacttctggaaatggagtgaattgattagccagaacttcaccacagctgaagct
gctccatcggaggcgcccgatgtctggagagatgtgacatttgtgtcaggacatccaacg
gtgaccttgttctggaagcctctatcaaaagtgcacgccaatgggaagatcctgttctat
aatgtagttgtagaaaatcttgatgaaccgtccagtttaaaggtcctctctgtccctgct
ccggccaacagcacaaaagtaaccctcaatcagagttcttaccagatctatgtcacggct
cacaacagtgtgggtccttctccggcttccgcagttgccatttctggacatcctggaaat
gaaaatgttgaagaaggaagaatgaatggtacagaggatggatttcccatgtcttggaaa
ccccaatccagaaatgccacaggttacgttgtggagtggtgtgacagtccccagcacctt
ccctgtgttctccggtggaaaaacctaggccccactaacacagacacagtcattagctcg
ggtgcttttagaccaggggttcgctacaacttcagaatttatgaaatttctacaaaaagg
atggcccatttattagagaaaaaagctggctatttgaaggaactggctccttcatacaac
cctaaagtgaatatgagtaacttgacctcccactccttcactctgagttggaaggattat
cccaccgaatcgcaaactggttttatacaagggtactatgtctacctgaaatccaagaca
ggggagaagtgccaccggggatttgaaaagacatttcttacagataattcagtatgttgc
aaatacacaattgacaacccggatcaaaagacatttgttgtgaaagacctacagccagaa
tctgcctatgagtttttggtcactccttatacaagtgctggtgagggtcccctggatgac
ttcagaaaggtcacgactccggatgaatactcccatatactgatacacatcattctcccc
atggttttcttcgtttttgtcatcatgatcatctgctacctaaaaagccagtggttgaag
gacaagtgttatcctgacattccagacccttacaagagcagcgtcctgtcattaataaaa
ttcaaggagaatcctcatataacaataatgaacgtcaatgactgtgttccagatgctatt
gaagttgtaaacaagcccgaagggagtaagatacagttcgtaggcactaggaagtcaccc
acagaaactaaaggtactaagcctgcctatctggacctgctcccaacagagaagaactac
tctggccctggaccttgcatctgttttgagaactttacctataatcaggcggcttctgac
ttgggttattgtggacatttcccagtaacccctcaagccccacactgtcagctgggacca
ctgacttcacctgaaaatttactaaagacactggaacaaaactacatgaactccctggga
gaaatcccagctggagaagctaatttgaattatgtatcccagttggcttcacccatgtct
ggagacagggagagcccaccaacaaatccaccagagccagcactctgttcggagtataaa
atgcaaatggctattcccctgggtcttgcctcccccgcccgaagtgagaatagcagccta
tcttccactgcccttttagatccgcatgaacactgccactaa

KEGG   Bos mutus (wild yak): 102277908
Entry
102277908         CDS       T02919                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin 11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102277908 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102277908 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102277908 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102277908 (IL11RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102277908 (IL11RA)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 EpoR_lig-bind ig
Other DBs
NCBI-GeneID: 102277908
NCBI-ProteinID: XP_005903110
UniProt: L8I6D6
LinkDB
Position
Un
AA seq 422 aa
MSSSCSGLSRVLVAVAAALVSASSPCPQAWGPPGVQYGQLGRALMLCCPGVTAGAPVSWF
RDGETRLLQGPASGLGPKLVLARAESTDEGTYTCRTLDGALRGMVTLRLGYPPARPVVSC
RAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCLQDPPGAARC
IVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHVVRVSARDFLD
AGTWSSWSPEAWGTPSTEPLPKEIPVGDQQHTQTEEEPQADSPAPPKPSLLPDPQPLDHR
DPLEQVAVLASLGIFSFLGLVAGALALGLWLRLRPDEKDGPQKSGLLAPMISVDKLPGVP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctgcagccctggtg
tctgcctcctctccctgcccccaggcctggggccccccaggggtccagtatgggcagctt
ggcagggccctgatgctgtgttgccctggagtgactgctggggccccggtgtcctggttt
cgggacggggagacaaggctgctccagggacctgcctctgggctagggcccaaactggtc
ctggcccgagcagaaagcactgacgagggcacctatacctgccggaccctggacggtgca
cttaggggcatggtgaccctgcggctaggctaccccccggcccgccccgttgtttcctgc
cgggctgctgactatgagaacttctcctgcacttggagtcccagccaggttagcggttta
cctacccgctacctcacctcctacaggaagaagactgtgccgggagctgatggccaaagg
atgagcccatccacagggccctggccatgcttacaggacccccctggggcggcccgctgt
atagtccatggggcagagttctggagccagtatcggatcaatgtgactgaagtgaacccc
ctgggggccagcacccgcctgctggatgtgagcttgcagagcatcttgcgccctgacccg
ccccagggcctccgggtagagtcagtgcctggctatcctcgccgcctgcgtgctagctgg
acataccctgcctcctggccccgccagccccacttcctgctcaagttccgtctgcagtac
cgtccagcacagcatccagcctggtctacggtggagccagctggattggaggaggtgatc
accgatgctgtggctgggctgccccatgtagtgcgggtcagcgcccgggactttctggat
gctggcacctggagctcctggagccccgaggcctgggggactccaagcactgagccccta
ccgaaggagataccagttggggaccagcaacacacacagacagaggaagaacctcaggca
gacagccccgctcccccaaagccgtcccttctacccgacccacagccacttgaccacaga
gaccccctggagcaggtggccgtgctggcatctttgggaatcttctctttcctgggactg
gtggctggggccctggcattggggctctggctaaggttgagaccagatgagaaggatgga
ccccaaaaatctgggctcttggccccaatgatttcagtggacaagcttccaggagtccca
aacctgtag

KEGG   Bos mutus (wild yak): 102279274
Entry
102279274         CDS       T02919                                 

Gene name
CRLF2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102279274 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102279274 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102279274 (CRLF2)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102279274 (CRLF2)
SSDB
Motif
Pfam: Tissue_fac
Other DBs
NCBI-GeneID: 102279274
NCBI-ProteinID: XP_014333885
LinkDB
Position
Un
AA seq 370 aa
MRHVFLPWAAAAVLLLGRANASGKTKLGSALQLQVINFNFETVQVTWNSSAYAGINFTFI
YKFHKKEEYRPCPDYILQHGYRAGCLLEVQRDGPLYFSIRNGTEPLLTKDLAISTYLKPR
SPGALSFQWREEAVTVTCSSLGYNDLQYEIQHKTVFDAEWQSTEAETCNVTIDGLDTEKC
YFFRARVKALEFAYGSETYPSDWSEVTYQQRGELRDSCWENSLFPKFILIAGMVSFLTVF
LLLLSLWKLHRIKKVLMPSVPDPKFSFLGLFESHQGNFQEWIKDTQNVAPLNKMEDGELE
CAPEDAVVVQPADAEMPKTVLMTSPLYSQTGEEEAIGDFSQLSRQPPQGRGVVSLGDFTF
VMSDHSYMML
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaggcatgtctttctgccctgggcggccgccgctgtcctcttgctgggacgcgcgaac
gcttcagggaaaaccaaactgggaagcgcattgcaacttcaggtgatcaactttaacttc
gaaacggtgcaggttacgtggaactcaagtgcatacgctgggattaatttcacgttcatt
tacaaattccataaaaaggaggaatatagaccatgccccgactacatccttcaacacggt
tacagggccgggtgcctgctggaggtacaaagagatggacctctgtatttttccatccgg
aatgggacagagcctcttctcaccaaggacctggccattagtacttacctgaaacccaga
tcccccggcgccctgagcttccagtggcgcgaggaggccgtgacggttacctgctccagc
ctgggatacaacgatctgcagtacgaaatccaacacaagaccgtctttgacgctgagtgg
cagtccacagaggcagagacctgcaacgtcaccatcgatggtttggatactgagaagtgt
tatttcttccgggccagggtgaaagccctggagtttgcctacggctcggaaacgtacccc
agtgactggtcagaggtgacataccagcagaggggtgagctgcgagattcgtgctgggaa
aacagccttttccccaaatttattttaattgctggcatggtctccttcctgacagtcttc
cttctgcttctgtctctgtggaaactgcacaggattaagaaggttctcatgcccagcgtc
cctgatcccaagttctccttcttggggctctttgagtcccaccaaggtaacttccaggag
tggatcaaggacacacagaatgtggcgcccttgaacaaaatggaagacggggagctggag
tgcgcccctgaagacgccgtggtggtccagccggctgacgccgagatgcccaagaccgtg
ctgatgacgagcccgctgtactcgcagacgggggaggaagaggccattggggatttcagc
cagctctctcgccagccgccccagggccgtggggtggtctctcttggggatttcacgttt
gtgatgagcgaccactcttacatgatgttatga

KEGG   Bos mutus (wild yak): 102279525
Entry
102279525         CDS       T02919                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin 20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102279525 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102279525 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102279525 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102279525 (IL20RB)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL10/28 receptor family
   102279525 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 LapA_dom DUF3805
Other DBs
NCBI-GeneID: 102279525
NCBI-ProteinID: XP_005889952
UniProt: L8IZH2
LinkDB
Position
Un
AA seq 305 aa
MVLEEIKTSLIMWFSYALIPCLFVDGVAVLPAPQNLSVQSTNMKHVLTWSPVTVPEEIVH
YSVEYQGEYESLYTSHIWIPSIWCSPTQRPECDITEDITATVSYSLRVRATLGSLTSTWS
TLKHRFNQNSTILTPPGMEITMDGFHLLIKLEDLGPHFEFFVSYWRREPGAKEHIKVVRP
GILPVYLETVEPGAAYCVKARTFVKAIGRHSAFSPTECVKVQGEALPLALALFAFVGFML
ILVVALLSVWKMGRLLRHSCCPVVMLPDTLKITNSPQKLISCRKEEVEACVTSGLSSEEL
FKAWI
NT seq 918 nt   +upstreamnt  +downstreamnt
atggttctagaagaaatcaagacaagtcttatcatgtggttttcctacgccttgattcct
tgtttgtttgtggatggagtggctgttctacctgcccctcagaacctctctgtgcaatca
accaacatgaagcacgtcttgacatggagcccagtgactgtgcctgaagaaatagtacac
tattctgtcgagtaccagggggagtatgagagcctgtacacaagccacatctggatcccc
agcatctggtgctcacccactcaaaggcctgagtgtgacatcacagaggacatcaccgcc
actgtgtcgtacagcctccgggtcagggccaccctgggctcgctgacctcgacctggagc
actctgaagcaccgctttaaccagaactcaaccatcctcaccccgcctgggatggagatc
accatggacggcttccacctgcttattaagctggaagatctggggccccattttgagttc
ttcgtgtcctactggagaagggagcccggtgccaaggaacacatcaaagtggtgaggccg
gggatccttcccgtgtacctggagacggtggagcccggggcggcatactgtgtgaaggcc
cggacgttcgtgaaggccatcgggcggcacagtgccttcagcccgacagaatgtgtcaag
gtgcaaggagaggccctgcctctggcgctggccctgtttgccttcgtgggcttcatgctg
atcctggtggtggcgctgctctccgtctggaagatgggccggctgctccggcactcctgc
tgccccgtggtgatgctccccgacaccttgaaaataacaaattcaccccagaagttaatc
agctgcagaaaagaagaggtagaagcctgtgtgacctcagggctctcttctgaggagctc
ttcaaggcctggatctag

KEGG   Bos mutus (wild yak): 102279567
Entry
102279567         CDS       T02919                                 

Gene name
CSF2RA
Definition
(RefSeq) colony stimulating factor 2 receptor alpha subunit
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102279567 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102279567 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102279567 (CSF2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279567 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102279567 (CSF2RA)
   04090 CD molecules [BR:bom04090]
    102279567 (CSF2RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL3 receptor family
   102279567 (CSF2RA)
CD molecules [BR:bom04090]
 Proteins
  102279567 (CSF2RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 102279567
NCBI-ProteinID: XP_014333889
LinkDB
Position
Un
AA seq 418 aa
MGNAALLRRLGSPGSLLATVVLLSMVLDSAWLLTQEQQDLPTVKPNASLNVKFDPQTTKL
TWDCKENASSGECVLIHKEKGPIKKKVKDSECQCTFQDCSLHGGVTLTVEVHVNQKRLSE
MLVYTNPGREGTAAQNFSCVIYDADFMNCSWAKGRAAPDDVQYFLYIRSKKRIERECPRY
LKDSGTHVGCHLQDLSGLTSYNYFLVNGTSQETGIQFFDSVLLLKEIEQYNPPDNITVQC
NESHCLIRWEKPRTRQQWPNREFQYQLDIQRQRDTSSGRSQLIVVFGDSGNRYNFPKPGS
KAKHTVKIRTADARKAHWGAWSQPVEFGSEETESSLVHIYVLLVLGTLVCGLTLGCLFKR
FLKSHRLFPPVPQIKDKLNDNHQVDHEMLWEKFTHETGKSDKEEVLTVETVSEAPAKL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggggaacgcagcgcttctgcgtcgtctgggcagccctggaagtctcctggcgacggtg
gtcctcctctctatggtgcttgactccgcgtggctcctcacccaggagcagcaggatctt
ccaaccgtgaagccaaacgccagtctaaatgtgaagtttgacccacagacaacgaagctg
acttgggactgcaaggaaaacgctagctctggggaatgtgtgctgattcacaaggagaag
gggccgattaagaaaaaggtcaaagacagtgagtgtcagtgcacgtttcaggactgttct
ctccacgggggagtcacgcttaccgttgaagtacatgtcaaccagaaacggctttcagaa
atgctggtctacactaacccaggtagggagggcacggctgcccaaaacttctcctgtgtt
atctacgacgcggatttcatgaactgcagctgggccaagggccgagcggctcccgacgac
gtccagtactttctgtacatccgatcaaagaaaagaatcgagagggaatgtcctcgttac
ctgaaggactcggggacccacgtgggatgtcacctccaagacctctcgggattaacgtcg
tacaattacttcctggttaacggtaccagccaagaaaccggaatccagttcttcgactcg
gttttgctgttaaaggaaatagagcagtacaacccacctgacaacatcaccgtccagtgc
aacgagtcccactgcctcatcaggtgggaaaagcccaggacccgacagcaatggcccaac
agggagttccagtaccagctggacatccagagacagcgcgataccagcagcggtagaagt
caactgattgtagtatttggtgattccgggaatagatacaactttccgaaaccgggatcc
aaagcgaaacatactgtgaagatcaggacagcggacgcccggaaagcccactggggagcc
tggagccagcccgttgagttcggctccgaagaaacggagtccagcctggtgcacatctac
gttctgctggtcctggggactctcgtctgtggcctgaccctcggctgccttttcaaaaga
ttcctcaagagccacaggttattccctccggttccacagatcaaagataaattgaatgat
aaccatcaagtcgaccacgagatgctatgggagaagtttacacacgaaacgggaaaaagt
gacaaggaagaggtcttaaccgtggagacagtctcagaagccccagcgaaactgtga

KEGG   Bos mutus (wild yak): 102279846
Entry
102279846         CDS       T02919                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102279846
   04151 PI3K-Akt signaling pathway
    102279846
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102279846
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102279846
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102279846
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279846
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102279846
   04090 CD molecules [BR:bom04090]
    102279846
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL3 receptor family
   102279846
CD molecules [BR:bom04090]
 Proteins
  102279846
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind TAP35_44
Other DBs
NCBI-GeneID: 102279846
NCBI-ProteinID: XP_014333887
LinkDB
Position
Un
AA seq 290 aa
MRYTQIHTADNRRPVGTASPMALPWLAVLLTLICCSMTTDHVKRPSLGSRPRRWAAVRDN
QPLPVVALFSAALAGTPLAAADNLTCRVHDVDQLSCSWAVGEEAPANVQYHFYLKHPLKT
WPCPKYMQNQQGVNVQCHFDGLSLQPERQSQFRFLVNGTSGGSKIPCRQMTHRLEEIEIL
AAPNITKKWCNENYSFMEWEVRSLFTEDIKYELEIQKGADLAYKEEVGIHPVRPPQSAVP
STGSLFPSVSRPSEMKLPSAQTGRYHLHTLLRGCIPRDVVTASSRPTDRI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcgctatacacagatacacacagctgacaaccgccgtcctgtgggaactgcctcgccc
atggccctcccctggctggccgtgctcctgacactcatctgctgctcgatgaccacggac
cacgttaaacggccgtcgctggggtcacggccgcgccgctgggccgccgtacgagataat
cagccgcttcccgttgtagccctcttctcagccgccttggcgggcacccccctggcggcc
gcggacaacctgacctgccgggtgcacgacgtggatcagctcagctgcagctgggcggtg
ggcgaggaggccccggcgaacgttcaataccatttctatctgaagcaccccttgaagacg
tggccgtgtcccaagtacatgcagaaccagcagggcgtcaacgtccagtgccattttgac
ggcctctcccttcaacctgaacgccaaagtcagttccgtttcctggtgaatggtaccagc
ggtggctccaaaatcccctgccgccaaatgacccatagattggaagaaattgaaatatta
gctgccccgaacatcacaaaaaagtggtgtaacgaaaactactcattcatggaatgggaa
gtaaggagtctctttactgaagacatcaagtatgaacttgagatacagaagggcgcggac
ctcgcctacaaagaggaggtgggtatccatcccgtgcggcccccgcaatctgccgtccca
agcacaggctccttatttccatcagtgtccagaccctctgagatgaagctccccagtgca
cagactgggcgttatcacctacataccctccttcgcggctgcatccctcgggatgtggtg
acagcatcctcacgcccaactgaccgaatctaa

KEGG   Bos mutus (wild yak): 102279969
Entry
102279969         CDS       T02919                                 

Gene name
CSF2RB
Definition
(RefSeq) colony stimulating factor 2 receptor beta common subunit
  KO
K04738  cytokine receptor common subunit beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04210  Apoptosis
bom04630  JAK-STAT signaling pathway
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102279969 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102279969 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102279969 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102279969 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102279969 (CSF2RB)
   04090 CD molecules [BR:bom04090]
    102279969 (CSF2RB)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL3 receptor family
   102279969 (CSF2RB)
CD molecules [BR:bom04090]
 Proteins
  102279969 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL4Ra_N EpoR_lig-bind IL2RB_N1 Tissue_fac
Other DBs
NCBI-GeneID: 102279969
NCBI-ProteinID: XP_005887519
LinkDB
Position
Un
AA seq 890 aa
MTLTQGLLPLALLVLCWGLSITGAEETVPMQTLRCHNDYTSRIICRWADTQDAQRLVNVT
LYRRPKEDHPQRVSCNLSDDKPWLNSPCPGCVPRKCVIPYRNFVLADFDYFSFRPDQPLV
TELTVNLSQHVQPPTPKDLNITATRESLLLFWSIAHEGFQSHWLSSLEFEVVYKRLQDSW
EDALTIHSKSPQAILELKDLQPSSTYVARVRTRLAPGSGLSGRPSQWSQEVSWNSQPGDE
AQPQNLQCFFDGATLLTCTWEVRSEVTHSVSFTLFYKTGPSAQEEECSPVQKETGSPYIQ
HRCQIPVPDPRNYSQYIVSVRPKVEERLIKSSDNIQMAPPTLNVTKGRDGYILHWREEKM
SYSHIACIFQVQYKKEGASWEDTKTEDFQNAHTMSLPPLEPASRYQARVRVKPDPGNYNG
IWSEWSEARSWDTDWVLPMWVLALILVISTLILLPVLHFCGVYGYRLNRKWEEKIPNPSK
SHLFQNGSAGLRMPDSMATLGSGSHPHKGPWGSSCPQLLEGVFPVDCRHSEVSPLTTEDP
KDACDSSSEPDMTLTASDLPTEQPPSPPTGLAAPSSRPESQASGFDFNGPYLGPPHSCSL
PDLMGQQVPPQTGVSRKPQSPGSLEYLCLPAGGQVQLVPLAQVKRQGKAGDGDTKSSPGA
QTSPSLESGVDPAPPEPGLMGVGQGQKDRAPTVLPTGWPEDGTVASGYVTTPDLIFTPPI
GAPSPSQAAPPNLPSDQNPTFHPGLADGPSVASAPQKPEFEGYVELPPATGQFPQSPLAS
PAPPRVSSPVLSPGPHRADVSPTSPTPEGLLVLQQVGDYCFLPGPLSPQSKPTSPGPCPE
IRDLNQVVQAKKPPAQAFPQVPAIQLFKALKQQDYLSLPPWDINRPGQVC
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgacactgacccaggggctgctccccctggctctgctggtgctctgctggggactcagc
ataacaggggctgaagagactgtcccgatgcagaccctgcgctgccataatgactacacc
agccgcatcatctgcaggtgggcggacacccaggatgcccagcgactggtcaacgtgacc
ctctaccgcaggcccaaggaggaccatccacagcgagtgtcctgcaatcttagtgacgac
aagccctggttaaacagcccttgtcctggctgcgtacccagaaaatgtgttattccttac
cgaaactttgtccttgccgactttgactacttctcattccgaccggaccagcctctggtc
actgagctcaccgttaatctgagtcagcatgtgcagccccccacacccaaggacctcaac
atcactgctaccagggagagtctcctgctgttctggagcatagcccatgagggtttccag
agccactggctgtccagcctggagtttgaggtggtctacaagcggcttcaggactcctgg
gaggatgccctcaccatccactccaagtccccccaggccatcttggagctaaaggacctt
cagcccagcagcacctacgtggcccgagtgcgcaccaggctggccccaggctcggggctc
tcaggacgacccagccagtggagccaggaggtttcctggaactcccagccaggggatgag
gcccagcctcagaacctccagtgcttctttgacggggccaccctgcttacctgcacctgg
gaagtgaggtccgaggtaacccactccgtctccttcaccctcttctacaagaccggcccc
agtgcacaggaggaagaatgctctcccgtgcagaaggagactggcagcccctacatccag
caccgatgccagattcctgtgcctgaccccaggaactacagccagtacatcgtctctgtt
cgaccaaaggtggaagagagacttataaagagctcagacaacatccagatggctccccca
accctcaacgtgaccaagggcagagatggctacatcctgcactggagagaagaaaaaatg
agctactcacacatagcttgcatattccaggtccagtacaagaaagaaggagcctcatgg
gaggacaccaagacagaggacttccagaatgcccacaccatgtcgctgccacctctggag
cccgccagccggtaccaggccagagtgagagtcaaacccgacccggggaactacaatggg
atctggagcgagtggagtgaagcaaggtcctgggacaccgattgggtgctgcccatgtgg
gtcctagccctcatcctcgtcatcagcaccttaatcctgcttccagtcctgcacttctgt
ggcgtctacgggtacaggctgaaccggaaatgggaggagaaaatccctaaccccagcaag
agccacctgttccagaacgggagcgccggactccggatgccagacagcatggccaccctg
ggcagtgggagccacccacataaggggccgtggggcagcagttgccctcagctcctggag
ggggtgttccctgtagactgcaggcacagcgaggtgtcacctctcaccacagaggaccct
aaagatgcctgtgactcatcatcagagccggacatgactctgactgcctcggatctcccc
acggagcagccccccagccccccgacagggctggctgccccctcaagcaggcctgagagc
caggcttccggctttgacttcaacggtccctatctggggccgccccatagctgctccctg
cctgacctcatgggccagcaggtgcccccacagacgggggtgagcaggaagccacagtcc
ccggggtccctggagtacctgtgtctgcccgcagggggacaggtgcagctggtcccgctg
gcccaggtgaagaggcagggcaaggccggggatggggacacaaagtccagcccaggggcc
cagacgagcccttccctggagtcaggggtggaccctgcccctccagagcctgggctgatg
ggggttggtcaaggtcagaaggacagggcccccacagttctgcccactggctggcctgag
gatggcaccgtagcctctggttatgtcaccaccccagatctgatattcaccccacccatc
ggggccccatctccctcccaggctgcccctccaaacctcccctcagaccagaaccccact
ttccatcctggactggctgatgggccctctgtagcctcagccccccagaaaccagagttc
gagggctatgtggagctccctccagccacaggccagtttccccagtcccctctagccagc
cctgcccctcccagagtcagcagccctgtcctgagcccaggcccgcaccgggcagatgtg
tcccccacctcccctacccctgagggtctccttgtcctgcagcaggtgggtgactactgc
ttccttcctggccctctctccccccagagtaagcctacttccccaggaccctgtcctgag
atcagggacctcaaccaggtggtccaggctaagaagcctccggctcaggcctttccccag
gtgcctgccattcagctcttcaaagccctgaaacagcaggactacttgtcactgccccct
tgggacattaacaggcctgggcaggtgtgctga

KEGG   Bos mutus (wild yak): 102280532
Entry
102280532         CDS       T02919                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102280532 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102280532 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102280532 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102280532 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102280532 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102280532 (IL6ST)
   05203 Viral carcinogenesis
    102280532 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102280532 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102280532 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102280532 (IL6ST)
   04090 CD molecules [BR:bom04090]
    102280532 (IL6ST)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102280532 (IL6ST)
CD molecules [BR:bom04090]
 Proteins
  102280532 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N Interfer-bind fn3_2 ObR_Ig SusE
Other DBs
NCBI-GeneID: 102280532
NCBI-ProteinID: XP_005887446
LinkDB
Position
Un
AA seq 918 aa
MFTLQTWIVQALFIFLTTESIGELLVPCAHIHPESSVVQLGSNFTAVCVLKEKCMDDYHV
TANDIFWKTGRVPVPYEQYSVINRTASSVTFPNITLINALLTCNIRMFGQINRSVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETYLETNYTLKSEWATEKFDDCKAKRDTPT
SCTVDYPPVYFVNIEVWVEAENALGKVTSDHINFDPIDKVKLNPPHILSVNSSKELSSIL
KLTWTDSRFKSFITLKYDIQYRTKDASTWNQVPPEDTSSTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPNFWYKIEPSHAHGTRSIQLKWKTLPPFEAN
GKILDYEVTLTKWKSHSQNYTVKDTKLTVNLTNDRYVATLTARNLVGKSDASVLTIPAWD
FQATHPITDLKAFPKDNVLWVEWTAPNESVNRYILEWCVLSDKSPCIPDWQQEDGTVHRT
YLRGNLVESKCYLITVTPVYDDGPGSPEHIKAYLKQAAPSRGPTVRTKKVGKNEAVLEWD
HLPIDVQNGFIRNYTIFYRTVIGNEIAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHFNSKDQMYPDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKVNT
EGHSSGIGGSSCMSSSRPSISSSDENESAQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSE
STQPLLDSEERPEDLQLVDNVDGSDGILPRQRYFKQNCSQHETSPDISHFERSQQVSSVN
EEDFVRLKQQQISDHISQPYGSGKMKMFQEVPAVDAFGPGIEGQVERFETVGMEDAVDEG
MPKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttcacattgcaaacttggatagtgcaagccttgtttattttcctcaccactgaatct
ataggtgaacttctagttccatgtgctcatatccaccctgaatcttcagttgtacaactt
ggttcgaatttcacggcagtttgtgtgctaaaggaaaaatgtatggatgattatcatgtg
actgctaatgacattttctggaaaacaggccgtgtacctgttccttatgaacaatatagt
gtcataaacagaacagcatctagtgtcacatttccaaatataactttaataaatgctctg
ctcacttgcaacattcgtatgtttggacagattaatcggagtgtttatggaatcagaatc
atttcaggcttgcctcctgaaaaacctaaaaatttgagttgcattgtgaatgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacaaactacacttta
aaatctgagtgggcaacagagaagtttgatgattgtaaagcaaaacgtgacacccccacc
tcatgcactgttgattatcctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaacgcccttgggaaggttacctcagatcatatcaattttgatcctatagataaagtg
aagctcaatccaccacatattttatcagtcaacagttcaaaggaactgtctagtatttta
aaattgacatggactgattcacgttttaagagttttataacactgaaatatgacattcaa
tataggaccaaagatgcctcaacttggaaccaggttcctcctgaagatacatcatctacc
cgatcttcattcactgttcaggaccttaaaccttttacagaatatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggatattggagtgactggagtgaagaagcaagtggtatc
acgtatgaagatagaccatccaaggcaccaaatttctggtataagatagagccgtctcat
gctcacggcactagatctatacaactcaaatggaagacattgcctccttttgaagctaat
ggaaaaattttggattatgaagtgactctcacaaagtggaaatcacattcacaaaattac
acagttaaagacacaaaactgacagtaaacctcacaaatgatcgctacgtagcaactctg
acagcaagaaatcttgttggcaaatcagacgcgtctgttttaactatccctgcctgggat
tttcaagctactcaccccataactgatcttaaagcatttcccaaagataacgtgctttgg
gtagaatggactgctccaaacgaatctgtaaacagatacatacttgagtggtgtgtgtta
tctgataaatcgccctgtatcccagactggcaacaagaagatggtactgtacatcgcacc
tatttaagaggaaacctagtagagagcaaatgttacttgataacagttactccagtatat
gatgatggaccaggaagccccgagcatataaaggcataccttaaacaagctgcaccttcc
agaggacctactgttcggacaaaaaaagtggggaaaaatgaagctgtcttagagtgggac
caccttcctattgatgttcagaatggatttatcagaaattatactatattttatagaacc
gtcattggaaatgaaatcgctgtgaatgtggattcttcccacacagaatacacactgtcc
tctttgactagtgacactctgtacatggtacgaatggcagcctacacagatgaaggtgga
aaggatggtccagaattcacttttactacaccaaagtttgctcaaggagaaattgaagct
attgttgtacctgtttgcttagcattcctattgacaacccttttgggagttttattctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacacacctccaaggcattttaattcaaaagatcaa
atgtatccagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgacaaa
aagcctttcccagaggatctaaagtctttggacctattcaagaaagaaaaagttaatact
gaaggacacagtagtggtattggagggtcttcatgcatgtcatcttctaggccaagcatt
tccagcagtgatgaaaatgaatctgcacagaacacttcaagcactgtccaatattccaca
gtggttcacagtggctatagacaccaggtaccatcagtccaagtcttctcaagatctgag
tccacccagcccttgttagattctgaagaacggccagaagatttacagctggtagataat
gtagatggcagtgatggcattctgcccaggcagcggtatttcaagcaaaactgcagtcaa
catgaaaccagtccagatatttcgcattttgaaaggtcacagcaagtttcctcagtcaat
gaagaagattttgttagacttaaacagcagcagatttcagatcatatttcacaaccctat
ggatctgggaaaatgaaaatgtttcaggaagttcctgcagtggatgcttttggtccaggc
attgagggacaagtagagagatttgaaacagttgggatggaggatgcagttgatgaagga
atgcctaaaagttacttaccacagactgtgagacgaggtggctacatgcctcagtga

KEGG   Bos mutus (wild yak): 102281523
Entry
102281523         CDS       T02919                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04066  HIF-1 signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05164  Influenza A
bom05168  Herpes simplex virus 1 infection
bom05200  Pathways in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281523 (IFNGR2)
   04066 HIF-1 signaling pathway
    102281523 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102281523 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102281523 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102281523 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    102281523 (IFNGR2)
   04659 Th17 cell differentiation
    102281523 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102281523 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102281523 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102281523 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102281523 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102281523 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    102281523 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    102281523 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102281523 (IFNGR2)
   05140 Leishmaniasis
    102281523 (IFNGR2)
   05142 Chagas disease
    102281523 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102281523 (IFNGR2)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IFN receptor family
   102281523 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 Pur_ac_phosph_N UL73_N
Other DBs
NCBI-GeneID: 102281523
NCBI-ProteinID: XP_005893429
LinkDB
Position
Un
AA seq 346 aa
MDSLAQLPAPGNLKVHLYNAQQALSWEPVSLDSDPRPVVYQVQYKYSTSSNWYDVNKEDS
KVDCTNLTRTECDFTANSLSEGFPRRFNISLRVRAKLGGLVSAWATAPWFEHYRNATIGP
PENIRVTPEEGSLIIRLSAPFDVPATEAYFVYCVYYWEKAGAKQVTRPFRSNFITLNDLK
PLRVYCFQVKAELFLTKENISRPGHLSNISCCETAADASVKLQQDFLAAGTTFLVLSVVV
GSCLFLVLRYRGLVKPWFHSPPRVPPQIEEYLKDPAQPILDALDKDSSPKDDTWDSVSVV
TFPENEQEGSPQSTLNQSAGPSHQPTEGVLCAKEAATCLSGLDGAT
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggactccctggcccagctgcctgctcctggaaacctgaaggttcacctgtacaacgcc
cagcaggcgctgagctgggagccggtgtccctggacagcgacccgaggccggtggtctac
caggtgcagtataaatacagcaccagtagtaactggtatgatgtcaacaaagaagatagc
aaggtggattgtacgaacctcaccaggacagagtgtgactttaccgcaaacagcctctcg
gaggggttcccacggcgtttcaacatctctttacgtgttcgagctaagctcgggggcctc
gtttctgcctgggcaacagcaccttggttcgaacactatcggaatgctaccattgggcct
ccagaaaacatccgggtgaccccagaagaaggctcccttatcatcaggctttctgctccc
ttcgatgtccctgccactgaggcctattttgtgtattgtgtctactactgggagaaggca
ggagctaaacaggtgacacgcccgttcaggagtaacttcatcacattgaatgatttaaaa
cccttaagagtatactgttttcaagtcaaggcagaactgtttttgaccaaagaaaacatc
tctcgacctggacatttaagcaacatatcttgctgtgaaacggcagcagatgcttctgtc
aagcttcaacaagacttcctggctgccggaaccacctttttggtgctgtcagtggtggta
gggtcctgtctcttcctggttctgagatacagaggcctggttaaaccctggttccactct
ccgccacgcgttccaccgcagatagaggagtatttaaaggatccggctcagcccatctta
gacgccctggacaaggacagctcgccaaaggatgacacttgggactccgtgtcggtcgtg
acgtttccagagaatgagcaagaagggagtccccaaagcactttgaaccaaagtgctggt
ccaagccaccagcccacggaaggagttctctgtgccaaggaagctgcgacatgcctgtca
ggactggatggagccacttga

KEGG   Bos mutus (wild yak): 102281719
Entry
102281719         CDS       T02919                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin 22 receptor subunit alpha 2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281719 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102281719 (IL22RA2)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL10/28 receptor family
   102281719 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102281719
NCBI-ProteinID: XP_005899182
LinkDB
Position
Un
AA seq 230 aa
MTPKCCFLGFLLSVLLPGVVETQPANESLKPQRVHFQSRNFHNILRWQPGQACLGNNSIY
FVQYKMYGERQWKNKETCWGIREFFCDLTNETSDIWEPYYGRVKTALAGVHSGWTMTQRF
IPWWETKIDPPVMNITHVNGSLLVNLHAPNLPYRDQEGENVSMEYYELVYRVFIFNNSLE
KEQKVYEGAHRVVEIKVTSPHTGYCVVAELYQPMLDRKSQRSRERCVETP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgacgccgaaatgttgctttctaggcttcctcctcagtgtcctcctgcctggtgtggta
gaaactcagccagccaacgagtctctgaaacctcaacgagtccattttcaatcccgaaat
tttcacaacattttgcgctggcagcctggacaagcttgtcttgggaacaacagtatctat
tttgtgcagtataaaatgtatggagagagacagtggaaaaataaagagacctgctggggg
attcgagagttcttctgtgaccttaccaatgaaacatcagatatatgggaaccttattat
gggagagtgaagacagctctggctggggtccactcaggctggaccatgacacagcggttc
attccatggtgggaaacaaaaatagatcctccagtcatgaatataacccatgttaatgga
tctttgttagtaaatctccatgctcccaacttaccatacagagaccaagaaggggaaaat
gtgtcaatggaatactatgagctagtatatcgagtcttcatatttaacaattcactggaa
aaggagcaaaaggtgtatgaaggagctcacagagttgttgaaattaaagttacctcacct
cacactggttactgtgtagtggctgagctataccagcccatgttagacagaaaaagtcag
agaagccgagagagatgcgtggaaactccttga

KEGG   Bos mutus (wild yak): 102282598
Entry
102282598         CDS       T02919                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04072  Phospholipase D signaling pathway
bom04144  Endocytosis
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04540  Gap junction
bom04630  JAK-STAT signaling pathway
bom04810  Regulation of actin cytoskeleton
bom05163  Human cytomegalovirus infection
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102282598 (PDGFRA)
   04014 Ras signaling pathway
    102282598 (PDGFRA)
   04015 Rap1 signaling pathway
    102282598 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102282598 (PDGFRA)
   04020 Calcium signaling pathway
    102282598 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102282598 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102282598 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102282598 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102282598 (PDGFRA)
   04540 Gap junction
    102282598 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102282598 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282598 (PDGFRA)
   05206 MicroRNAs in cancer
    102282598 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102282598 (PDGFRA)
   05231 Choline metabolism in cancer
    102282598 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102282598 (PDGFRA)
   05218 Melanoma
    102282598 (PDGFRA)
   05215 Prostate cancer
    102282598 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102282598 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102282598 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102282598 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bom04090]
    102282598 (PDGFRA)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102282598 (PDGFRA)
Protein kinases [BR:bom01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102282598 (PDGFRA)
CD molecules [BR:bom04090]
 Proteins
  102282598 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 Kinase-like LAT
Other DBs
NCBI-GeneID: 102282598
NCBI-ProteinID: XP_005907695
UniProt: L8HUZ5
LinkDB
Position
Un
AA seq 1089 aa
MGTSHWALLVLGCLFTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGIVPASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYECAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDNHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITGVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcttcacagggccgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacagtgctggaagtggtcagcgcctcggcggcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcaggcacatttacatctac
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcggtcatcatcccatgccgcacgactgatcctgagactccagtgacc
ttactcagcagtgaggggatagtgcctgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacggtcagagggaagaagttccagacc
attccattcaatgtttatgcttacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtgtataaggcaggcgaatcaattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcagtggacttaccctggacaaatgaaaggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagcggccattatactattgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccatcctccatactggacttg
gttgacaaccaccatggctctaatgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaatgaaact
tcatggacagttttggccaacaacgtttcaaacatcatcacaggggtccacccccgagac
aggagcacagtggaaggccaggtgacgtttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcggctgctgtcctggtgttgttggtgattgtgatcatc
tcactcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccaatgcagctg
ccttacgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcatttgggaaagtggttgaaggaactgcttatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccgcatttaaacatcgtgaacttg
ctgggcgcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttac
gttatcttatcttttgaaaataatggtgactacatggacatgaagcaagctgacacgaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagca
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggcctgactttgttggatttgttgagctttacctat
caagtcgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtccaaaggcagtacctttctccccgtgaag
tggatggctcctgagagcatctttgacaacctgtacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggagatcttttcccttggtggcacaccctaccctggcatgatg
gtggactctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgaaattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggactttctgaagagtgaccatcccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaagacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctacgttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

KEGG   Bos mutus (wild yak): 102283329
Entry
102283329         CDS       T02919                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283329 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102283329 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102283329 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102283329 (CNTFR)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102283329 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Receptors
  102283329 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 ig Ig_5
Other DBs
NCBI-GeneID: 102283329
NCBI-ProteinID: XP_005903126
LinkDB
Position
Un
AA seq 382 aa
MAAPVPWACCAVLAAAAAVVYAQRHSPQETPHVQYERLGSDVTLPCGTASWDAAVTWRVN
GTDLAPDLLNGSQLVLRSLELGHGGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKMMVCEKDPAVKNRCHIRYMHLFSTVKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGAASAPSFVSVPVTLAL
AAAAATASRLLICPQTGPPGSL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgccgtgctcgctgctgctgctgccgtggtc
tacgcccagagacacagtccgcaggagactccccacgtgcagtacgagcgcctgggctca
gacgtgactctgccgtgtgggactgccagctgggacgcagcggtgacgtggcgggtgaat
ggcacagacctggcccccgacctgctcaacggctctcagctcgtgctccggagcctggag
ctgggccacggcggcctgtacgcctgcttccaccgggactcctggcacctgcgccaccag
gtgcttctccatgtgggcttgccgccgcgggagcccgtgctcagctgccgctccaacact
tatcccaagggcttctactgcagctggcatctgcccactcccacctacatccccaacacc
ttcaatgtgaccgtgctgcatggctccaaaatgatggtctgtgagaaggacccggccgtc
aagaaccgctgccacatccgctacatgcacctgttctccaccgtcaagtacaaggtctcg
ataagtgtcagcaacgccctgggccacaatgccacagccatcacctttgatgagttcacc
atcgtgaagcctgaccctccggaaaatgtggtagcccggccagtgcccagcaaccctcgc
cggctagaggtgacttggcagaccccgtcgacctggcccgacccggagtcctttcctctc
aagttctttctgcggtatcgacccctcatcctggaccagtggcagcatgtggagctgtca
gacggcacggcacacaccatcacagatgcctacgctggcaaggagtacatcatccaggtg
gcggccaaggacaacgagattgggacgtggagcgactggagcgtggctgcccacgccacg
ccctggacggaggagccacgacacctgaccactgaggcccaggcccccgagaccacgacc
agcaccaccagctcactggcacccccgcccaccacgaagatctgtgaccccggggagctg
ggcagcggcggggcagcctcggcgccctccttcgtcagtgtccctgttactctggccctg
gctgccgctgctgccactgccagccgtctcctgatctgtccccagactgggcctccaggt
tccctttga

KEGG   Bos mutus (wild yak): 102284161
Entry
102284161         CDS       T02919                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284161 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284161 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102284161 (IFNLR1)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL10/28 receptor family
   102284161 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind Ribosomal_60s
Other DBs
NCBI-GeneID: 102284161
NCBI-ProteinID: XP_005900780
LinkDB
Position
Un
AA seq 524 aa
MTGARRWAPLLLCLLQSAPGRPLLAPPQNVTLLSRDFSVYLTWLPGPGNPQNVTYFVAYQ
SFAPPRRWRRVKKCAGTKELVCSLMCLEKQDLCNKFKGRVQAVSPSARSPWVESKFMDYF
FEVEPAPPVLVFNQTEEILIVNATYQLPHCLPQPDMNYEVNFWKEGTKNKTRFPDTRHGQ
PVQIPLQPDTSGHHCLSARTIYFFGNPKYSEFSEPTCFFLEAPGSNWALLLLLPFLLPLL
LAVAIGPVMWKTFRENPWFQQTKMPQALSFSGHRLCGATFQPGGPECLHNLIVCPQKEVT
RRVRLTSRVRAPAPVQARPEKDSAEEKDGEESTDEEDLDPGVSFQPYVEPPPFLGQEAQS
PGPTKAGEPWTPLVQGEGSSACSSSGRSWVSTAGSSSPWDEAGSSGYLAKKGPGQGMGRE
EHQKPLPPPKDSSSLGEPSKDNLSSWTSWGLSSPGPNLVPGEPPVSLRTLTFCWDSSPED
DEGEEEEEEEGWRESESEDSGAGSWGAKSLQRTEVRPLGHYLAR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgacgggggcccgacgctgggcccccctgctcctgtgtctgctgcagtccgctccaggg
cggcccctcctggcccctccccagaatgtgacgctgctctcccgggacttcagtgtgtac
ctgacgtggctcccagggcctggaaacccccagaacgtgacctattttgtggcctatcaa
agctttgcaccccccagacggtggcggagagtgaaaaagtgtgcaggaaccaaagagctg
gtgtgttctctaatgtgcctggagaagcaagacctgtgcaacaagttcaaggggcgtgtg
caagcagtttcacccagcgccaggtccccctgggtagagtccaagttcatggattacttc
tttgaagtggagccagccccacctgtcctggtgttcaaccagacagaggagattctgatt
gtcaatgctacataccagctgccgcattgtctgccccaaccagatatgaactatgaggtg
aatttctggaaggaagggactaagaacaagacccggtttccagacactcgccatggccag
ccagtccagattcctctccagccagacaccagtgggcaccactgcctcagcgccagaacc
atctacttctttggcaaccctaaatacagcgagttctccgagcccacctgcttcttcctg
gaggccccgggatccaactgggccctcttgttgctgctaccatttctgcttccactgctg
ttggctgttgccatagggcctgtgatgtggaagaccttcagggagaacccctggtttcag
cagacaaagatgccacaggccctgagcttctccggacacagactctgcggggcaaccttt
cagcccggtggcccagagtgcctgcacaacttgatcgtatgtccccaaaaggaagtgacc
agaagggtcaggctgacctctagagtcagggccccagcccccgtccaggccagaccagag
aaggacagcgctgaggagaaggacggtgaggagagcacagatgaagaggacctggatcct
ggcgtcagcttccagccctatgttgaaccgccgcccttcctggggcaggaagcccagagc
ccggggcccaccaaggcaggagagccctggactcctctggtccagggggaagggtcctct
gcctgcagttcttcaggcagaagctgggtcagcactgcggggtcctcctccccctgggat
gaggctggatcctcgggctatttggccaagaaggggccaggccaggggatgggtcgggag
gaacaccagaagcctctcccaccacccaaggactccagttccctgggagagccctccaaa
gacaacctctcctcctggaccagctggggcttatcatcaccagggccgaatctagtcccc
ggagaacccccagtttctcttcggacactgaccttctgctgggacagtagtcctgaggat
gatgagggggaggaagaagaggaggaagagggctggagggagtcagaaagtgaggacagc
ggtgctggcagctggggggctaagagcctccagaggaccgaggtcagacccttggggcat
tacttggccaggtga

KEGG   Bos mutus (wild yak): 102284614
Entry
102284614         CDS       T02919                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin 22 receptor subunit alpha 1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284614 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284614 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102284614 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102284614 (IL22RA1)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL10/28 receptor family
   102284614 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 102284614
NCBI-ProteinID: XP_005900782
UniProt: L8IBB8
LinkDB
Position
Un
AA seq 581 aa
MRTLLTILAAGSLLAHITEDTSDLLQHVKFQSSNFENILTWDGRLESAPDTVYSVQYKTY
GEEEWLEKEGCQRITQKSCNLTMETSNLTELYYARVTATDGAGRSATKMTNRFSSLQHTS
IKPPDVTCIPKVRSIQMIVHPTYTPIRAQNGHQLTLENIFQDLLYHLKLRINHTYQMHLE
GKQREFEFVGLTPDTEFLGTIMICIPNLFKESTPYMCRVKTLPDRTWTYSFSGAFLFSLG
FLVAGLCYLSYRYITKPPPPPSSLNVQHILPFQPLRFIQEHTLIPVFDLSGSGGLAQPVQ
YSEVKVSDPTEPLGPPPRHSLPEIAYLGQPDFPVLRPSGGPPHQALPVLSYAPQAAPEGR
PSSYAPQGALEAKPPSYTPQAVSETQLPSYTPRATPDNWPPSYGMCGEGSGRDSPPVTRS
GPKHLGTKGQLQKEVPAGSCSPTGLSLQEVTPLAMEDPQEAKSSHQCLRVHTDSDSDSDT
IGQREPGTRSSLKGQLPLLSSVQIEGHPGCLPLQTPSLPCSPTDKGPSPWGLLESLVCPS
DEDPVSKTEAESPGLQAPDQESPTELDSLFRGLALTVQWES
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaggacgctactgaccatcctggcggcgggatccctgctcgctcacatcactgaggac
acctcagatctccttcagcacgtgaagttccagtccagcaacttcgaaaacatcctgacg
tgggacggcaggctggagagtgcccccgacaccgtctacagcgtccagtataagacgtat
ggagaggaagagtggttggaaaaggagggctgccagcggatcacccagaaatcctgcaac
cttaccatggagacgagcaacctcactgagctctactacgcccgggtcaccgccactgac
ggagcaggccggtctgccaccaagatgaccaaccgcttcagctcactgcagcacactagc
atcaaaccacctgatgtgacctgtatccccaaggtaagatccatccagatgatcgtccat
cccacctacacaccaatccgcgcacagaatggccaccagctgaccttggagaacatcttc
caggacctactctaccacttaaagctgcgcatcaaccacacctatcaaatgcaccttgaa
gggaagcagagagaatttgagtttgtcggcctgacccctgacacggagttccttgggacc
atcatgatttgtattccaaacttgttcaaggagagcaccccctacatgtgccgagtgaag
acgttgccagatcggacgtggacctactccttctccggtgccttcctgttctccctgggc
ttcctggtcgcagggctctgctacctgagctacagatacatcaccaagccgcctccacct
cccagctccctgaatgtccagcacatcctgcccttccagcctctgcggttcatccaggag
cacaccctgatccccgtcttcgacctcagcggctccggtggtctggcccagcctgtccag
tactccgaagtcaaggtctccgaccccacggagcccctgggacctccaccgcggcacagc
ctgcctgagattgcctaccttgggcagccagacttccccgtcctccggccctccggagga
ccccctcaccaggcactccccgtgctctcctatgccccccaggctgctcccgagggcagg
ccctcgtcctatgcacctcagggagctctggaagctaaacccccctcctacactccacag
gctgtctcagagacccagcttccctcctacaccccacgggccaccccggataactggcct
ccttcctacgggatgtgcggggaagggtctgggagagactccccccctgtgacacgctct
ggtcccaaacacctcggaactaaggggcagctccagaaagaggtgccagctggaagctgc
agcccaactggcctttcgctacaggaggtgacccccctggccatggaggacccccaagaa
gcaaaatcctcccaccagtgtctaagggttcacaccgactcagactctgactctgatacc
ataggccaaagggagccaggaacacgaagctccctaaagggccagctgcccctcctctcc
tctgtccagatcgagggccaccccgggtgcctccctttgcagactccttccctcccatgt
tcccccacagacaagggtccaagtccctggggcctgctggagtccctcgtgtgtcccagt
gatgaggatccagtgtccaagactgaggccgagagcccaggccttcaggccccagaccag
gagtcgcccacggagctggactctctgttccgaggcctggccctaacagtgcagtgggag
tcctga

KEGG   Bos mutus (wild yak): 102284629
Entry
102284629         CDS       T02919                                 

Gene name
IL7R
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04068  FoxO signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
bom05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284629 (IL7R)
   04068 FoxO signaling pathway
    102284629 (IL7R)
   04151 PI3K-Akt signaling pathway
    102284629 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284629 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102284629 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102284629 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    102284629 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102284629 (IL7R)
   04090 CD molecules [BR:bom04090]
    102284629 (IL7R)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102284629 (IL7R)
CD molecules [BR:bom04090]
 Proteins
  102284629 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 102284629
NCBI-ProteinID: XP_005905026
UniProt: L8I241
LinkDB
Position
Un
AA seq 459 aa
MTLLSIALGTLFYLLQAVSGESGYAENGDFDDAELDDYSFSCYSQLEVDGLQHLLTCMFD
DSDINSTNLEFEICGALLDVDCLNFNKLQERYFLKTKKFLLIGDSKICVKLEKKNMTCRK
VNIVKIVKPEAPFDVRVVYREGANDFVVTFNTSHLQKKYVKVLIHEVAYRQEKNENNWMR
VNLTSTKLTLLQRKLQPNAMYEIKVRSIPYANYFEGFWSEWSPSFHFRTPETNSTGETDP
VLLTISILSFFSVALMVTLACVLWKKRIKPIIWPSLPDHKKTLEQLCKKPKKNLNVSFNP
ESFLDCQIHKVDGIQAKDEAEGFLQDPLPPQPEESDKQRFRAGMQGPSWPSEQAGITPKI
FRGESPFRCLAGNASVCDAPGLLSSRSPNGREGGKSRPLVYQDLLLGPGTTNSSLPPPFP
FQPGILTLNPVAQGQPILTSLGSSQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacacttctaagtattgctttgggtacgcttttctatttacttcaagccgtttctgga
gaaagcggctatgcagagaatggagattttgacgatgcagaactggatgactactcattc
tcatgctacagtcagctggaagtggatggactccagcacttgctgacctgcatgtttgat
gactcggacatcaacagcaccaatctggaatttgaaatatgtggggcgcttttggatgta
gattgcctgaattttaataaactgcaagagaggtatttcctcaagacaaagaaattctta
ctgattggagacagtaaaatatgtgtgaagcttgaaaaaaagaacatgacttgcagaaaa
gtgaacatagtcaagatagttaaacctgaggctccttttgacgtcagagtcgtctatcgt
gagggagcaaatgactttgtggtgacatttaatacatcacacttgcagaagaagtatgtg
aaagtattaatacatgaggtagcctaccgtcaggaaaaaaatgaaaataattggatgcgt
gtgaatttaaccagtaccaagctgacactcctacagagaaaactacaacccaatgccatg
tatgagattaaagttcggtccatcccttacgccaactattttgaaggcttctggagtgaa
tggagtccaagtttccactttagaactccggagaccaacagcacaggggagacggatcct
gtgttactaactatcagcattctgagcttcttctctgtggctctgatggtcactctggcc
tgtgtcttatggaaaaaaagaattaaacctattatatggcccagtctccctgatcataag
aagactctggaacaactgtgcaagaaaccaaaaaaaaatttgaatgtgagtttcaatcct
gaaagtttcctggactgccagattcataaggtggatggcattcaagctaaagatgaagca
gaaggcttcctgcaagaccctcttcctccacagccagaagagagtgacaagcagaggttc
agagccgggatgcagggtcccagctggccctccgagcaagcaggcattacccctaaaatt
ttcagaggagagtcaccattcagatgcctggctgggaatgccagtgtgtgtgatgcccct
gggctcctctcctccaggtctcctaatggcagggaaggtggcaagagcagacctctagtg
taccaggacctgctccttggacctggaactacaaacagctccctgccccctccgtttcca
ttccaacccggaatcctgacattgaaccctgttgcccaggggcagcccatcctcacttcc
ttgggatcaagtcaagaagaagcctatgtcaccatgtccagcttctaccaaaaccaatga

KEGG   Bos mutus (wild yak): 102284639
Entry
102284639         CDS       T02919                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04144  Endocytosis
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284639 (IL2RB)
   04151 PI3K-Akt signaling pathway
    102284639 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284639 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102284639 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102284639 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102284639 (IL2RB)
   04659 Th17 cell differentiation
    102284639 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102284639 (IL2RB)
   05202 Transcriptional misregulation in cancer
    102284639 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102284639 (IL2RB)
   05162 Measles
    102284639 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102284639 (IL2RB)
   04090 CD molecules [BR:bom04090]
    102284639 (IL2RB)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102284639 (IL2RB)
CD molecules [BR:bom04090]
 Proteins
  102284639 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 102284639
NCBI-ProteinID: XP_014333548
LinkDB
Position
Un
AA seq 582 aa
MKEGQGTGQMLSAPARGSLPQPPPVDVMAAPALSCCLSLLILLLLLAIPQTSTAVNDASN
ITCFYNSRANVSCIWSHDEGLRATTCCFHSRQPQRCWNHTCELQPVRPGSWACNLVLGHS
PEAQKLTIVDIMKLTVMCSEGGKWRRMMTQDIKPFDYIRLIPPHSLQVVRIETHRCNITW
TVSQVSHYIQNDVEFEARLRYADHSWEDARLLTLRQNQQWISLENLAPGMEYELQVRAKP
RLGSHEVWSHWSQPLAFRTVPAETKKKIPPLPWLNHIFLGIGSFFGLVLLVYFLGSFQCI
RLWLKNVLKCHIPDPSEFFSQLSSEHGGDFQKWLSSPFPSSSFSRSGLDPEISPLEVLDR
DAKATQLLLLQQDKGSSSSAETSGHSVTSCFTNQGYFFFHLPDALEIEACQVYFAYDPCT
EELDEGGPRAPEGALLPPLPTPPGDDDAYCTFPPGEDLLLFSPSLLSGPGPPNIAQWGTG
AGEERLASSPQEGVPGDWTPQPLRPPALEAPDLVDLQSSPEHELGEARERVPGPSPREGT
SFPWASPPGQGQVRAPTVCLTLNTDAYLSLQELQDQDPAYLV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgaaggaagggcagggcacaggtcagatgctctctgcccctgccaggggctcccttccc
cagcccccacccgtggatgtgatggcggctccggctctgtcctgctgtctgtccctgctc
atcctcctcttgctgctggccatccctcagacatctacagcagtgaatgatgcttccaac
atcacatgcttctataactcgagagccaacgtctcctgcatctggagccatgatgagggc
ctgcgggccaccacctgctgcttccacagccgtcagcctcagaggtgctggaaccacacc
tgtgagctgcagccagtgaggccaggatcctgggcatgcaacctggtcctgggacattct
ccagaagctcagaaactgaccatagtggacatcatgaaattgacggtgatgtgctctgaa
ggcgggaagtggaggaggatgatgacccaggatatcaagccctttgattacattcgtctg
attccaccccactcactccaggtcgtccgcatagagacccataggtgcaacataacctgg
accgtctcccaggtatcccactacatccaaaacgacgtggagtttgaggcccggttaagg
tacgccgaccacagctgggaggacgcccggctactgaccctcaggcagaaccagcaatgg
atctccctggagaatctcgctccaggcatggaatatgagcttcaggtgcgggccaagccc
cggctaggcagccacgaggtttggagccactggagccagcccctggccttcaggacagtc
cctgcagaaaccaagaagaagatcccacctctcccttggttgaaccacatcttcttgggc
attggcagtttctttggtcttgtcctcttggtttactttctgggcagcttccagtgcatc
aggctatggctgaagaatgttctcaagtgtcacatcccagacccctcggagtttttttcc
caactgagctctgagcatggaggagatttccagaagtggctctcttcacccttcccctcg
tcctccttcagccgcagtggcctggaccctgagatctccccactggaggtgttggacagg
gacgccaaggccacacagctgctcctgctgcagcaggacaagggctcgtcatcctcagct
gagaccagtggccactcggtgaccagctgcttcaccaaccaaggctacttcttcttccac
ctcccagatgccctggagattgaggcctgccaggtgtacttcgcttacgacccctgcaca
gaggagcttgatgagggtgggcccagggcccccgagggagctctccttccacccctgccg
actccaccaggggatgacgatgcctactgcaccttcccccccggggaagacctgctactc
ttctctccgagtctcctcagtggtccaggtcccccgaacattgcccagtggggcactggg
gctggtgaagagaggctggcctccagcccacaggagggagtccctggagactggaccccc
cagcccctgaggcctcctgctctggaagcccctgacctggtggatctgcagtcatcccca
gagcatgagctgggagaagcaagagagagggtacctggtcccagtccaagggaggggacc
agcttcccctgggccagccctcctgggcaaggccaagtcagggcccccactgtctgcctg
accctgaacactgatgcctacttatccctccaagagctccaggatcaggacccagcttac
ttggtatag

KEGG   Bos mutus (wild yak): 102284739
Entry
102284739         CDS       T02919                                 

Definition
(RefSeq) interleukin-9 receptor-like
  KO
K05073  interleukin 9 receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284739
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284739
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102284739
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102284739
   04090 CD molecules [BR:bom04090]
    102284739
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   102284739
CD molecules [BR:bom04090]
 Proteins
  102284739
SSDB
Other DBs
NCBI-GeneID: 102284739
NCBI-ProteinID: XP_014338497
LinkDB
Position
Un
AA seq 456 aa
MSTDQWEGTSRVGMSAWPPQDGHSEVLMREAGTCFLLCAWLSLGVPVLGDRGGPGPGAFT
CYNNNILRIECRWPGPALGQGAGSWLLFTSNVVPGSKHKCVFWAGVCTVELPPEEVLVPA
DNFTITFHHHISGKEQVSLVDPQYLPRRHVKLDPPSDLQSNVSSEHCVLTWSVSPALEPL
AMLLSYELAFKRQEEAWEWARHKDHIVGVTWLKLEAAELDPGSAYEARLRVQMAALEGEV
AEEERYEGVWSDWSQPACFAAPPRRGRLVPALGQSDSTLVAVSLFLLLSSLIYLLFKLSP
RMKTALYKDVPSPGPFFQPLYSVHNGDFQTWIGARGASPQAGRDHAGPPRGALLEAHVRE
AVALLHCDPADAWPSAGLEEEGGPGPGLPAGVLPAGHVEWGVPSPAYLPQEDWAPAGRPR
LAPPRCEGSSGDYCALDCSRPAILAPIHHFPPCFRA
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtccacggaccagtgggaagggacgagccgggtggggatgtcggcctggcccccgcag
gacgggcatagcgaagttctgatgagagaggcgggcacctgcttcctgctctgcgcctgg
ctcagcctgggggtccctgtcctgggagacagaggagggccagggcctggggctttcacc
tgctacaataacaacatcctcaggattgagtgccgctggcctggcccagcgctgggccag
ggggccggctcctggctgctcttcaccagcaacgtcgtgccgggcagcaagcacaagtgt
gtcttctgggctggcgtgtgcaccgtggagctgccgcccgaggaggtcctcgtgcctgct
gacaacttcaccatcaccttccaccaccacatctccgggaaggagcaggtcagccttgtg
gatccacagtatctgccccggagacacgtgaagctggaccccccctcggacttgcagagc
aacgtcagctctgagcactgtgtcctgacctggagcgtcagtcctgccttggagccgctg
gccatgctcctcagctatgaactggccttcaagaggcaggaggaagcctgggagtgggct
cggcacaaggatcacatcgttggggtgacctggctcaaacttgaagccgccgagttggac
cctggttctgcctatgaggcccggctgcgagtccagatggctgccctagagggcgaggtg
gcggaggaggagcgatacgagggcgtgtggagtgactggagccagcctgcctgctttgcc
gctccccccagacgaggtcgcctggtccctgctctggggcagtctgatagcaccctggtc
gctgtgtccctcttcctcctgctgagcagcctgatctacttactgttcaaactgtcgccc
aggatgaagacagctttgtacaaggatgtgccgtccccaggcccattcttccagcctctg
tacagcgtgcacaacggggacttccagacctggataggggcccgcggagccagcccacag
gctggccgggaccatgccggccccccacgaggagccctcctggaagcccatgtccgggag
gccgtcgctttgctgcactgtgacccagcagacgcctggccgtcggcgggcctggaggag
gagggcggccctgggcccggcctcccggcaggtgtgctgccagcaggacacgtggagtgg
ggggtgccgtcgcccgcctacctgccacaggaggactgggcccctgcgggccgcccccgg
ctggcgcccccccggtgcgagggcagcagtggcgactactgtgccctggactgctctcgt
cctgccatcctggcccccatccaccacttccctccctgcttccgggcttaa

KEGG   Bos mutus (wild yak): 102286576
Entry
102286576         CDS       T02919                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin 12 receptor subunit beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286576 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102286576 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102286576 (IL12RB1)
   04659 Th17 cell differentiation
    102286576 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286576 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102286576 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102286576 (IL12RB1)
   04090 CD molecules [BR:bom04090]
    102286576 (IL12RB1)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102286576 (IL12RB1)
CD molecules [BR:bom04090]
 Proteins
  102286576 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind fn3_4 DUF1935
Other DBs
NCBI-GeneID: 102286576
NCBI-ProteinID: XP_005897970
LinkDB
Position
Un
AA seq 726 aa
MGQWGFRLVALLLLLCHRQGAEACSTVGCCFQNPPYPDADSGSASGPRAPSCYRVFSSAG
YECSWEYEGPAAGVSHFLRCCLQSGRCCYFATGSATKLQFSDQDGISVLHNVTLWVESRA
ANRTEKSPNVTLNLYSSVKYDPPPENIKVSKSAGKLRMEWETPARQDGAQVQFRHRTPGS
PWKLGDCGHQDDAGFESCLCPLEMDMAQEFQLRRRLGPGVPRGPWSSWSSPVCIPPETPP
QAEVRFSVEQLRPDGRRQVTLHEQLPQLELPEGCLGPDSGMEVTYHIHLHMLSCPCKTRA
KRTLRLKKKLVLSSAAYDLAVVSRNRFGLGPNQTWHIPACIHSEPGLLNISAGANGTTIR
WPARAQGMRYCIEWQLQGQEENLAACIVTAPQDPDAAGTATHSWSQESGALEQKACYRIT
IFASAHPEKPTSWSTVLSTYHFGGNASEAGSPQHVSVRKLSQDSVSVDWTPSLLSTCPGV
LKEYVVCCQEEDSNQVSELHVKPTETQVTLQGLRAGTAYKVQVRADTAKRRGAWSQPLRF
SIEVQVSELSDLSIFLASLGSFVSILLLGIFGYLGLNRAVRHLCPPLPTPGASTAIKFSG
SQGKQVWQWTSPADFPEEVSPQEALMVNISWEKGEGADMGTLGTLKEKTELPLHAPKPAL
DLKDRKQMQGCPEAGAPGPGWQDGLVEDSLAQAARSPLLLLGGLGWTPRFGSQGETGASA
SSYREA
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggggcaatgggggttcaggctggttgccctccttctcctcttgtgccacagacagggc
gctgaagcctgcagtaccgtcggatgctgttttcagaacccaccatacccagatgcagac
tcaggctcagcttcaggccccagggccccaagctgctaccgggtgttcagcagcgctggt
tatgaatgttcctgggagtacgagggccctgcagctggagtcagccacttcctcagatgc
tgcctccagtctggccgctgttgctactttgccacaggctcggccaccaagctgcagttc
tccgaccaggatggcatatccgtgctccacaatgtcactctctgggtggaatcccgggcc
gccaaccggacagagaagtcccccaacgttaccctgaacctctacagctcagttaaatac
gaccctcccccagaaaacatcaaggtgtccaagtcagcagggaagctgcgtatggagtgg
gagaccccagcccgccaggatggtgcccaggtacagttccggcaccgcacacctggcagc
ccgtggaagctgggtgactgtggacatcaggatgatgctggcttcgagtcatgcctctgc
cccttggagatggacatggcccaggaattccagctgcggcggcgtctggggccaggggtc
cccagaggtccctggagcagttggagcagccctgtgtgcatcccccctgaaacccctcca
caggctgaggtgaggttctcagtagagcagcttcgcccagatgggaggaggcaggtgacc
ctgcatgagcagctgccccaactggagcttccggaaggctgccttgggcctgactctggg
atggaggtgacctaccacatccatctgcacatgctgtcctgcccatgtaagaccagggcc
aagaggactctgcgcctgaagaaaaagctcgtcctctcgagtgctgcctatgatctggcc
gtcgtttcccggaatcgctttggcctcggccccaatcagacatggcacattcctgcctgc
atccactcagaaccagggcttctgaatatcagtgccggagccaacgggaccaccatacgt
tggccagcccgggcccagggaatgaggtactgcattgagtggcagctccagggccaggag
gagaaccttgccgcctgcatcgtgacggccccccaggacccggacgctgctgggacggca
actcacagctggagccaagaatctggggcactggaacagaaggcatgttaccgcatcacc
atctttgcctctgcacacccagagaagccaacctcatggtctacggtcttgtccacctac
cattttggaggcaatgcctcagaggccggaagcccacagcacgtgtcggtgaggaaactc
agccaggattcggtgtctgtggactggacaccatctctgctgagcacctgccctggcgtc
ctgaaggagtatgttgtgtgctgccaggaggaggacagcaaccaagtatctgagctgcac
gtgaagcccacagagacccaggtcaccctccaaggcctgcgggctggcacagcttacaag
gtgcaggttcgcgcagatacagccaagcggaggggtgcctggagccagcccctgcgtttc
agcatcgaagtccaggtttctgagttgtccgacctgtccatcttcctcgcatctttgggg
agtttcgtgagcatccttctcctgggaatctttgggtacctcggcttgaacagggctgta
aggcacctgtgcccacccctgcccacacctggtgccagcactgccatcaagttctctggc
agccaggggaagcaggtttggcagtggaccagcccagcagacttcccggaggaggtgtct
ccacaagaggccctgatggtgaatatatcctgggaaaaaggcgagggagctgacatgggc
acacttgggactctcaaggagaagacggagctgcctctgcatgcccctaagccagccctg
gacttgaaggacaggaagcagatgcaaggatgccctgaggctggggctccggggcctggc
tggcaggacggtctggtggaggacagccttgcccaggcggctaggtccccactgctgctc
ctggggggcctagggtggacccccaggttcggttcccagggagaaacaggagcgtctgcc
tcctcctacagagaagcctga

KEGG   Bos mutus (wild yak): 102286871
Entry
102286871         CDS       T02919                                 

Gene name
MPL
Definition
(RefSeq) MPL proto-oncogene, thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286871 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102286871 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102286871 (MPL)
   04090 CD molecules [BR:bom04090]
    102286871 (MPL)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  Prolactin receptor family
   102286871 (MPL)
CD molecules [BR:bom04090]
 Proteins
  102286871 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind ObR_Ig Tissue_fac
Other DBs
NCBI-GeneID: 102286871
NCBI-ProteinID: XP_005898427
UniProt: L8IEB2
LinkDB
Position
Un
AA seq 644 aa
MPSWALLAVISYLLPVPQYLAQVTSQDVSSLASDSESLNCFSRTFEDLTCFWDEEEGAPS
EMYQLLYAYPGEQPRTCPLSSQHVMPFRTRYVCQFPAQAEVRLFSQLHLWVKNVFLNQNL
TQRVLSVDAVGLPTPPSLIKAMGGSQPGELQISWEAPAPEINEFLRHELRYGPKDPRNSS
GATVTQLLSAETCCPARRRPNLAAALDPSPCSQPMMPQQTGPEQNSPTREAPSLTTKGGS
CLISGLQPGNSYWLQLRSQPDGVSLRGSWGSWSLPVTVDLPGDAGEIGLQCFTLDLTNVT
CQWQQQDHASSQGFFYHSRARCCPRDRDPVWEKCEEEKNSGSQSSQFSRCHFKSQNNSAI
HILVEVTTAQGAVHSYLGSPFWIHQAVLIPTPNLHWREVSSGQLELEWQHPSAWAAQETC
YQLRYTAEGHQDWKVLEPPLGAQGETLELRPRSRYRVQLRARLHGPTFQGPWSSWSDPVR
VETASETVWIFLVTALLLVLSVSALLGLLLLRWQFPEHYRSLRHALWPSLPDLHRVLGQY
LRDTAALSPPKAAVSDVYEEVEPSLLEILPRSSEKAPLPLCSSQAQLDYRGLQPSCLGTM
PLSVCPPMAEPGSYCATHIANHSYLPLSCWQVPRSQYPGQIQTL
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttggcggtcatctcctacctcctcccggtcccccaatacctg
gcacaagtcaccagccaagatgtctcctcgctggcctcggactcagagtccctgaactgt
ttctctcgaacctttgaggacctcacttgcttctgggatgaggaagagggagcgcccagt
gaaatgtatcagctgctgtatgcctatccgggggagcagccccgcacctgccccctgagt
tcccagcatgtgatgccctttagaacccgctacgtgtgccagtttccggcccaggctgaa
gttcgcctcttctctcaactgcacctctgggtgaagaatgtgtttctgaaccagaatctg
acccagcgggtgctctctgtggatgccgtgggcctgccaactccccccagtctcatcaag
gccatgggtgggagccagccaggggaacttcagatcagctgggaggccccagctcccgaa
atcaatgaatttctgaggcatgaactccgctatggccccaaggaccccaggaactccagt
ggcgccacagtcacacagctgctgtctgcagaaacctgctgcccagctcggcggaggcca
aacctagcggcagccctggacccgtctccatgttcacagcccatgatgcctcaacagact
ggaccggagcagaactccccaactagagaggctccatctctgacaacgaagggtggcagc
tgcctcatctcaggactccagcctggtaactcctactggctccagctacgcagccaacct
gatggggtctctctccgtggttcctggggatcttggtccctcccagtgactgtggacctg
cctggtgatgcaggggaaattggactacaatgctttaccttggacctgacgaatgttacc
tgtcagtggcaacaacaggaccatgccagctcccaaggcttcttctaccacagcagggca
cggtgctgccccagagacagggaccccgtctgggagaagtgtgaagaggagaaaaactca
ggatcacagtcctcccagttctcccgctgccacttcaagtcacaaaataacagtgctatt
cacatccttgtggaggtgaccacagcccagggtgctgttcacagctacctgggctcccct
ttctggatccaccaggctgtgctcatccctactccaaacttgcactggagggaagtctcc
agcgggcagctggaactggaatggcagcatccatcagcctgggcagcccaagaaacctgc
tatcagctccgatacacagcagaaggccatcaggactggaaggtgctggagccacctctt
ggggctcagggagagaccttggagttgcgcccgcgctcccgctaccgcgtacagctgcgc
gccaggctccacggccccaccttccaaggtccctggagctcttggtccgacccagtgagg
gtggagacggcctcggagacggtctggatcttcctggtgactgctctgctcctggtcctg
agcgtcagcgccctcctgggcctgctgctgctgaggtggcaatttcctgagcactacagg
agcctgaggcatgccctgtggccctcacttccagacctacaccgggtccttggccagtac
cttagggatactgcagccctgagtccgcccaaggctgcagtctcagatgtctatgaggaa
gtggaacccagcctccttgaaattctacctagatcctcagagaaggctcccttgcccctg
tgttcctcccaggcccagttggactaccgaggattgcagccttcttgcctggggaccatg
cccctgtctgtgtgcccaccaatggctgagccagggtcctactgtgccactcacatcgcc
aaccattcctacttaccactcagctgctggcaggtccctcgctcccagtaccctggacag
atccaaactctctag

KEGG   Bos mutus (wild yak): 102287439
Entry
102287439         CDS       T02919                                 

Gene name
IL6R
Definition
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04066  HIF-1 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04659  Th17 cell differentiation
bom04932  Non-alcoholic fatty liver disease
bom05163  Human cytomegalovirus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102287439 (IL6R)
   04066 HIF-1 signaling pathway
    102287439 (IL6R)
   04151 PI3K-Akt signaling pathway
    102287439 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102287439 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102287439 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102287439 (IL6R)
   04659 Th17 cell differentiation
    102287439 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102287439 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102287439 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102287439 (IL6R)
   05163 Human cytomegalovirus infection
    102287439 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102287439 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102287439 (IL6R)
   04090 CD molecules [BR:bom04090]
    102287439 (IL6R)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102287439 (IL6R)
CD molecules [BR:bom04090]
 Proteins
  102287439 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind fn3 Ig_6
Other DBs
NCBI-GeneID: 102287439
NCBI-ProteinID: XP_005898712
LinkDB
Position
Un
AA seq 399 aa
MTGSHHGRPAGMGRRLLLQSVQLSDSGNYSCYREDHPAGSVRLVVDVPPEKPQISCIQKS
PLSRVNCEWSPRSPPSLTTKAVLLVKKFPKQVFQEPCQYSPESQRFSCQLAVPEGDSSFY
VLSLCVANSVGNKSSNPLGFDGYKLLQPDPPVNITVSAVDRNPRWLSVTWQDPPSWNSYY
YRLQFELRYRTERSETFTTLMLKDPQYHCIINDAWSGMRHVVQLRAQEEFGNGLWSEWSP
EVTGTPWTESRSSTTTKLPTSTQAPTTTEDNENIFSKDSAKTTSLPVQDSTSVPLPAFLV
AGGSLAFGTLLCIGIILRFKKTGKLQALKEGKTSAHPSYSLGQLVPERPKPTPALVPLIS
PPVSPSSLESDNTSRNSRPDAKGPGSPYDVSNRDYFFPR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgacaggctcgcaccacggcagaccggctggcatgggaaggcggctgcttttgcagtcc
gtgcagctcagcgactccggaaactattcatgctaccgggaagaccacccagctgggagc
gtgcgcttggtggtggatgttcccccggagaagccccagatctcctgcatccagaagagc
cccctcagtagagtgaattgtgagtggagtcctcggagccctccatccctgaccaccaag
gccgtgttactggtgaaaaagtttccgaagcaagtcttccaggagccctgccagtattcc
cccgagtcccagcgcttctcctgccagttggctgtccctgagggagatagctctttctac
gtattgtccctgtgtgtcgccaacagtgtcgggaacaagtccagcaaccccctaggattt
gacggctacaaactcctacagcccgacccacccgtcaacatcacagtcagcgccgtggac
agaaacccccgctggctcagtgtcacctggcaggaccccccctcctggaactcatattac
tacaggctacagtttgagctccgataccggactgaacggtcagagacattcacaacactg
atgctgaaggatccgcagtaccactgcatcatcaatgatgcctggagtggcatgaggcat
gtggtgcagcttcgggcgcaggaggaatttgggaatggcttgtggagcgagtggagcccc
gaggtcaccggcaccccttggacagagtccaggagttctactacgaccaagctgcccacc
tccacgcaggcacctactactactgaagataatgaaaatattttctccaaagattctgca
aaaacaaccagcctcccagtgcaagattctacttcggtaccactgcccgcattcctggtg
gctggaggaagcctggccttcgggaccctcctctgcatcggcatcatcctgaggttcaag
aagacggggaaactgcaggctctgaaagaaggcaagacaagtgcacacccgtcctattct
ttgggccagctggttcctgagaggcccaagcctaccccagcgcttgtccccctcatctcc
ccaccggtgtcccccagcagccttgaatctgacaacacatcgaggaacagccggccggat
gctaagggccctggaagcccttatgacgtcagcaacagagactacttcttccccagataa

KEGG   Bos mutus (wild yak): 102287947
Entry
102287947         CDS       T02919                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin 27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102287947 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102287947 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102287947 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    102287947 (IL27RA)
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL6/12 receptor family
   102287947 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 102287947
NCBI-ProteinID: XP_005888087
LinkDB
Position
Un
AA seq 639 aa
MLLLLLLLLLLFSRTRPQGSPGPLQCYGVGPLGDLNCSWEPHGDLGAPSMLYVQSQKYHS
NKTWTVAVPTGQNWVTIPREQLTTSDELLVWAAKAGQLLWSPVFVNLETRMKPDAPHLYP
DVDFSDDHPLEAVVQWAPPTWPPHKVLVCRFYYRRCRMPWVMLEPEVKSIPLMPIEIQDL
ELATGYEMFGRCQVDKEEDLWGEWSPILPFQTPPSAPKDVWIMGNICGAPGGQEPLLLWK
ASGLCMQVTYRVWIQVKDQEVIQEETPYCNFSIPTQAEWVGVSAVNATSWEIPTNLSLTC
LGPDFAPHGVVVRSISGNTELLVTWQQEPGELQEHVVDWIRDGDPVEDLNWVRLPPGNLS
AVLPVDFKEGVPYRITVTAISPWGLAPAPSVWKFREELVPLSGPVVWRIQDAPSGTPAVA
WGEVPRQQLRGHLTHYTLCTQSGTRPSVCKNVTGSTRTITLPDLHWGPCKLWMTASTIAG
QGPPGPSLQFHLPDNTLNWKVLSVVFLLWGLLLTGCGVSLATCGRCVHLQHKVLPHWVWE
KIPDPANSNFSLPHMKEVPQAQPPGDSPILEVEEIEQVPVKEPPQPLAPLDSGYEKHFLP
TPEELGLLSPTAGSRLRPELTSGGERGTPLTDEDIEAQS
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgctgctgctgctgctgcttctattgttgctgttcagccggactcggccccagggcagc
ccggggccactgcagtgctatggagttggacccttgggggacctgaactgctcctgggag
cctcatggggacctgggagccccctccatgctgtatgtccagagccagaaataccattcc
aacaaaacctggaccgtggcggtgcccaccggacagaactgggtgaccatcccacgggaa
cagcttaccacgtctgacgaactccttgtctgggcggccaaggccggccagcttctctgg
tccccagtctttgtgaacctcgaaacccgaatgaagccagatgccccccacctataccct
gacgtggacttctcagatgaccaccccctggaggccgttgtccagtgggcccctcctacg
tggccaccccataaggtcttggtctgccggttttactatcgaaggtgccggatgccctgg
gtgatgctggaaccggaagtgaagtctatacctctgatgcccattgagatccaggacctg
gaactggccactggctacgagatgttcggccgctgccaagtggacaaagaggaggatctg
tggggcgagtggagccccattctgcccttccagacaccaccctctgctccaaaagatgtg
tggatcatggggaacatctgtggggcaccaggtggacaggaacccctgcttctgtggaag
gcttcagggctctgcatgcaggtgacctacagagtctggatccaggttaaggatcaggag
gtgatccaggaggagaccccctactgcaacttctccatccccacccaagcagagtgggtg
ggggtgtctgctgtgaatgccacaagctgggaaattcctaccaacctctctttgacctgc
ttgggtccagactttgccccccatggcgtggtggtcaggagcatctctggaaacacagag
ctgctggtgacttggcaacaggagcctggggagctgcaggagcatgtggtggactggatt
cgagacggcgaccccgtggaggacctcaactgggtccggcttcctcctgggaacctcagt
gcagtgttgccagtggatttcaaggaaggggtcccctaccgaatcacggtgaccgcgatc
tctccgtggggcttggccccggccccctccgtctggaagttcagagaggagctagtaccg
ttatcggggccagtggtttggcgaatccaggatgccccctcagggacccctgctgtagca
tggggagaggtcccaaggcagcaactccggggccatctcacccactacaccctgtgtaca
cagagtggaaccaggccttctgtctgcaagaacgtgactggcagcacccgaaccatcacc
ctgcctgaccttcactggggtccctgcaagctgtggatgactgcctccaccatcgcagga
cagggcccacctggtccaagcctccagtttcacctaccagataacaccctgaattggaaa
gttctgtcggttgtctttctgctgtggggtttgctcctgaccggctgtggtgtgagcctg
gccacctgcggaaggtgtgtccacctgcagcacaaggtactgccccactgggtctgggag
aagattcctgaccctgccaatagcaacttcagcctgccacacatgaaggaggtgccccag
gcccagccccctggtgactcacccatcctggaagtggaggaaatagagcaggttccagtt
aaggagcccccccagcccttggcaccactggactctgggtatgagaaacacttcctgccc
acgcctgaggagctgggccttctaagccccactgcaggctccaggctacggcctgaactg
acctcaggaggggagaggggaactcctttgacagatgaagacatagaggctcagagctga

KEGG   Bos mutus (wild yak): 106700824
Entry
106700824         CDS       T02919                                 

Definition
(RefSeq) interleukin-2 receptor subunit beta-like
  KO
K05069  interleukin 2 receptor beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04144  Endocytosis
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106700824
   04151 PI3K-Akt signaling pathway
    106700824
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106700824
   04061 Viral protein interaction with cytokine and cytokine receptor
    106700824
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106700824
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    106700824
   04659 Th17 cell differentiation
    106700824
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106700824
   05202 Transcriptional misregulation in cancer
    106700824
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106700824
   05162 Measles
    106700824
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bom04050]
    106700824
   04090 CD molecules [BR:bom04090]
    106700824
Cytokine receptors [BR:bom04050]
 Interleukin receptor families
  IL2 receptor family
   106700824
CD molecules [BR:bom04090]
 Proteins
  106700824
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 106700824
NCBI-ProteinID: XP_014333623
LinkDB
Position
Un
AA seq 289 aa
MAAPALSCCLSLLILLLLLAIPQTSTAVNGLSISSPGRNRSGRGTLEGHECPTASPTRRI
FTAYASNITCFYNSRANVSCIWNHDEGLQANTCCLHSRQPQRELLFPTKQWNHTCELQPV
RPGSWACNLVLGHSPEAQKLTIVDIMKLTVMCSEGGKWRRMMTQDIKPFDYIRLIPPHSL
QVVRIETHRCNITWTVSQVSHYIQNDVEFEARLRYADHSWEDARLLTLRQNQQWISLENL
APGMEYELQVRAKPRLGSHEVWSHWSQPLAFRTVPAVALRHMGSYRTRD
NT seq 870 nt   +upstreamnt  +downstreamnt
atggcggctccggctctgtcctgctgtctgtccctgctcatcctcctcttgctgctggcc
atccctcagacatctacagcagtgaatggactgagcatctcctcacctggtaggaacagg
agtggcaggggaacccttgaaggccatgagtgccctacagccagccccacacgccgcatc
ttcacggcatatgcttccaacatcacatgcttctataactcgagagccaacgtctcctgc
atctggaaccatgatgagggcctgcaggccaacacctgctgcttgcacagccgtcagcct
cagagagagctgctttttcctacaaaacagtggaaccacacctgtgagctgcagccagtg
aggccaggatcctgggcatgcaacctggtcctgggacattctccagaagctcagaaactg
accatagtggacatcatgaaattgacggtgatgtgctctgaaggcgggaagtggaggagg
atgatgacccaggatatcaagccctttgattacattcgtctgattccaccccactcactc
caggtcgtccgcatagagacccataggtgcaacataacctggaccgtctcccaggtatcc
cactacatccaaaacgacgtggagtttgaggcccggttaaggtacgccgaccacagctgg
gaggacgcccggctactgaccctcaggcagaaccagcaatggatctccctggagaatctc
gctccaggcatggaatatgagcttcaggtgcgggccaagccccggctaggcagccacgag
gtttggagccactggagccagcccctggccttcaggacagtccctgcagttgctctgaga
catatgggatcttataggaccagagactga

DBGET integrated database retrieval system