KEGG   Bos mutus (wild yak): 102264498
Entry
102264498         CDS       T02919                                 

Gene name
CCR5
Definition
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04062  Chemokine signaling pathway
bom04144  Endocytosis
bom05145  Toxoplasmosis
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102264498 (CCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102264498 (CCR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102264498 (CCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102264498 (CCR5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102264498 (CCR5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102264498 (CCR5)
   05163 Human cytomegalovirus infection
    102264498 (CCR5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102264498 (CCR5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102264498 (CCR5)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    102264498 (CCR5)
Cytokine receptors [BR:bom04050]
 Chemokine receptors
  CC Chemokine
   102264498 (CCR5)
CD molecules [BR:bom04090]
 Proteins
  102264498 (CCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx TMEM192 DUF2976
Other DBs
NCBI-GeneID: 102264498
NCBI-ProteinID: XP_005900956
LinkDB
Position
Un
AA seq 352 aa
MDYQTSTPLYDIDYGMSEPCQKLNVRQIAARLLPPLYSLVFIFGFVGNMLVVLILINCKK
LKSMTDIYLLNLAISDLLFIITIPFWAHYAADQWVFGNTTCQLFTGFYFIGYFGGIFFII
LLTIDRYLAIVHAVFALKARTVTFGAATSVVTWVVAVFASLPGIIFTKSQKEGSRHTCSP
HFPSSQYHFWKNFQTLKIVILGLVLPLLVMIVCYSGIIKTLLRCRNEKKKHKAVRLIFVI
MIVYFLFWAPYNIVLLLSTFQEFFGLNNCSGSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLRFFRKYFASRFCKGCPVFQGEAPERVSSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattatcaaacatcaactcccctctatgacattgattatgggatgtcagagccatgc
caaaaactcaacgtgaggcaaattgcagcccgcctcttgcccccactctactcgctggta
ttcatctttggttttgtgggtaacatgctggttgtcctcatcctgataaactgcaaaaag
ctgaagagcatgactgacatctatctgctcaacttggccatctctgacctacttttcatc
atcaccatcccattctgggctcactatgctgcagaccagtgggtctttggaaatacaacg
tgccagttattcacagggttctatttcattggttattttggtggaatcttcttcatcatc
ctcttgacaatcgataggtacctggctatcgtccatgctgtgtttgctttaaaagccaga
acagtcacctttggggcggcgacaagtgtggtcacctgggtggtggctgtgtttgcctct
ctcccaggaattatctttaccaaatcccaaaaagaaggctctcgtcatacatgcagcccg
catttcccatccagtcagtatcatttctggaagaatttccaaactttaaagatagtcatc
ttggggctggtgctgccactgcttgtcatgatcgtctgctattcgggaatcataaaaacc
ctgctccggtgtcgcaacgagaagaagaagcacaaggctgtgaggctcatcttcgtgatc
atgattgtctactttctcttctgggctccctacaacatcgtccttctcctgagcaccttc
caggaattctttggcttgaataactgcagtggctctaacaggctggaccaagccatgcag
gtgacagagaccctggggatgacgcactgctgcatcaaccccatcatctacgccttcgtg
ggggagaagttccgaaactatctcttacggttcttccgaaagtacttcgccagccgcttc
tgcaaaggctgtccagtcttccagggagaggctccagagcgagtaagctccgtttataca
cgatccacaggagaacaggaaatctctgttggcttgtga

DBGET integrated database retrieval system