KEGG   Bos mutus (wild yak): 102264521
Entry
102264521         CDS       T02919                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04020  Calcium signaling pathway
bom04024  cAMP signaling pathway
bom04211  Longevity regulating pathway
bom04371  Apelin signaling pathway
bom04380  Osteoclast differentiation
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04921  Oxytocin signaling pathway
bom04925  Aldosterone synthesis and secretion
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05214  Glioma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102264521 (CAMK4)
   04020 Calcium signaling pathway
    102264521 (CAMK4)
   04024 cAMP signaling pathway
    102264521 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102264521 (CAMK4)
   04925 Aldosterone synthesis and secretion
    102264521 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    102264521 (CAMK4)
   04720 Long-term potentiation
    102264521 (CAMK4)
   04722 Neurotrophin signaling pathway
    102264521 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102264521 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    102264521 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    102264521 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    102264521 (CAMK4)
   05034 Alcoholism
    102264521 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102264521 (CAMK4)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102264521 (CAMK4)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102264521 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 102264521
NCBI-ProteinID: XP_014332013
LinkDB
Position
Un
AA seq 266 aa
MKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNC
EYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKL
QEFNARRKLKAAVKAVVASSRLGSASSSHSGVQEGRASREPSPPQAGDGGVPGAEGAPGA
AEGAGVELPEVQAGEEVSGADGDAAAPRVEPHASEEEMEEAGPETEGRPAGETRGPAGAP
AAPEGREEDPALEVGAQQGDAVLPED
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaagacagtatgtggaaccccagggtactgcgcacctgaaatccttagaggctgtgcc
tacggacccgaggtggacatgtggtctgtggggataatcacctacattttactttgtgga
tttgaaccattctatgatgagagaggtgatcaattcatgttcaggagaattctgaattgt
gaatattactttatctccccctggtgggatgaagtgtctctgaatgccaaggatctggtc
agaaaattaattgtgttggatcctaagaaaaggctgactacctttcaagctctccagcac
ccgtgggtcacaggtaaagctgccaattttgtacacatggatacggctcaaaagaagctc
caagaattcaatgcccggcgcaagctcaaggcggcggtcaaggccgtggtggcctcctcc
aggctcggcagcgccagcagcagccacagcggcgtccaggagggccgggccagccgggag
ccgtctccacctcaggctggcgacgggggcgtcccaggggccgagggggccccgggggca
gccgagggggccggggtggagctgccagaggtgcaggcgggggaggaggtcagcggtgct
gatggagacgccgcggcccccagggtggagccccatgcatccgaggaggagatggaggag
gccggcccggagacggaggggcgcccggcgggggagacgcgggggcccgctggagccccg
gcagccccggaaggacgggaggaggaccctgccctggaggtcggagctcagcagggtgac
gcggtcctgccggaggactag

DBGET integrated database retrieval system