KEGG   Bos mutus (wild yak): 102264680
Entry
102264680         CDS       T02919                                 

Gene name
CREB3L2
Definition
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102264680 (CREB3L2)
   04024 cAMP signaling pathway
    102264680 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    102264680 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    102264680 (CREB3L2)
   04152 AMPK signaling pathway
    102264680 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102264680 (CREB3L2)
   04922 Glucagon signaling pathway
    102264680 (CREB3L2)
   04915 Estrogen signaling pathway
    102264680 (CREB3L2)
   04926 Relaxin signaling pathway
    102264680 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    102264680 (CREB3L2)
   04918 Thyroid hormone synthesis
    102264680 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    102264680 (CREB3L2)
   04916 Melanogenesis
    102264680 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    102264680 (CREB3L2)
   04927 Cortisol synthesis and secretion
    102264680 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102264680 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102264680 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    102264680 (CREB3L2)
   04728 Dopaminergic synapse
    102264680 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    102264680 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102264680 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102264680 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    102264680 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102264680 (CREB3L2)
   05020 Prion disease
    102264680 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    102264680 (CREB3L2)
   05031 Amphetamine addiction
    102264680 (CREB3L2)
   05034 Alcoholism
    102264680 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102264680 (CREB3L2)
   04934 Cushing syndrome
    102264680 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102264680 (CREB3L2)
   05161 Hepatitis B
    102264680 (CREB3L2)
   05163 Human cytomegalovirus infection
    102264680 (CREB3L2)
   05165 Human papillomavirus infection
    102264680 (CREB3L2)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102264680 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY
Other DBs
NCBI-GeneID: 102264680
NCBI-ProteinID: XP_005897746
UniProt: L8IHJ3
LinkDB
Position
Un
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITASDSFNDDEVESEKWYLSPDF
PPTTIKTEPITDEPPSGLVPSVTLTITAISTPFEKEETPLEMNAGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVDHLHLPPTPPSSNSSDSEGSLSPSPRLHPFGLPQTHSPARAPA
RAPSALASSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
SSVVRSRNLLIYEEHSPLEEPPSSASAGELGRWDRGSALLRAKGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHMVSTNLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggagaccgaggctctcatgtaccacacgcacttctcggagcttctg
gatgagttttcccagaatgtcttgggccagctcctcaacgaccctttcctctcagagaag
agcgtgtcgatggaggtggagccatccccgacgtccccggcacccctcatccaggccgag
cacagctactccctatgtgaggagcctcgggcccagtcgccattcacccacatcacggcc
agtgacagcttcaatgacgatgaagtggagagtgagaaatggtacctgtctccagacttt
ccaccaacaaccatcaagacagagcccatcacggacgagccaccctcaggactcgtcccc
tctgtcacgctgaccatcactgcaatctccaccccgtttgaaaaggaggaaacccctctg
gaaatgaacgctggggttgattcctcatgccagaccattattcctaagattaagctggag
cctcatgaagtggatcagttcctaaacttctctcccaaggaagcctccgtggaccacctg
cacttaccgcccactcctcccagcagcaacagcagtgactccgagggcagcctgagcccc
agcccgcgcctgcacccctttggccttccgcagacccacagccctgccagggccccagcg
cgggccccctcggcgctggccagctccccgctcctcactgctcctcataagctgcaggga
tcaggccccctggtcctgacggaggaggagaagaggaccctgatcgccgagggctatccc
atccccaccaagttgcccctgacgaaatcagaggagaaggccctaaagaaaatccggagg
aaaatcaagaataagatttcagcccaggaaagtaggaggaagaagaaagaatacatggac
agcttggagaaaaaggtagagtcttgttcaacggagaacttggagcttcggaagaaggtg
gaggttctggagaacaccaacagaactctcctgcagcagctgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagctggccggcacgcagactggcacatgcctt
atggtcgtggtgctgtgctttgccgtagcatttggcagcttctttcagggctatgggccc
tatccttctgccaccaagatggccctgcccagccagcattccctgcaggaaccctacaca
tcctccgtggtgagatccaggaacctgctgatctatgaggaacattctcccctggaggag
ccacccagttccgcctcagctggggagctgggacgctgggaccgaggctctgctctgctc
agggcaaaagggctggagtccaggccggacgtggatcttccccatttcattatctcaaat
gagaccagcctggagaaatcagtgctgttggagctgcagcagcacatggtcagcaccaac
ctggaggggaatgagacactaaaagtcgtagaactcgacagaagagtgaacgccaccttt
taa

KEGG   Bos mutus (wild yak): 102267423
Entry
102267423         CDS       T02919                                 

Gene name
ATF4
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04137  Mitophagy - animal
bom04141  Protein processing in endoplasmic reticulum
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04720  Long-term potentiation
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04932  Non-alcoholic fatty liver disease
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom05010  Alzheimer disease
bom05012  Parkinson disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102267423 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102267423 (ATF4)
   04668 TNF signaling pathway
    102267423 (ATF4)
   04022 cGMP-PKG signaling pathway
    102267423 (ATF4)
   04151 PI3K-Akt signaling pathway
    102267423 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102267423 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    102267423 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102267423 (ATF4)
   04922 Glucagon signaling pathway
    102267423 (ATF4)
   04912 GnRH signaling pathway
    102267423 (ATF4)
   04915 Estrogen signaling pathway
    102267423 (ATF4)
   04926 Relaxin signaling pathway
    102267423 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    102267423 (ATF4)
   04918 Thyroid hormone synthesis
    102267423 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    102267423 (ATF4)
   04925 Aldosterone synthesis and secretion
    102267423 (ATF4)
   04927 Cortisol synthesis and secretion
    102267423 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102267423 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    102267423 (ATF4)
   04728 Dopaminergic synapse
    102267423 (ATF4)
   04720 Long-term potentiation
    102267423 (ATF4)
   04722 Neurotrophin signaling pathway
    102267423 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    102267423 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102267423 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    102267423 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102267423 (ATF4)
   05012 Parkinson disease
    102267423 (ATF4)
   05014 Amyotrophic lateral sclerosis
    102267423 (ATF4)
   05020 Prion disease
    102267423 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    102267423 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    102267423 (ATF4)
   05031 Amphetamine addiction
    102267423 (ATF4)
   05034 Alcoholism
    102267423 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102267423 (ATF4)
   04934 Cushing syndrome
    102267423 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102267423 (ATF4)
   05161 Hepatitis B
    102267423 (ATF4)
   05163 Human cytomegalovirus infection
    102267423 (ATF4)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    102267423 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 Fez1 AAA_13 Nop53 bZIP_Maf DUF4795
Other DBs
NCBI-GeneID: 102267423
NCBI-ProteinID: XP_005899514
UniProt: L8IC38
LinkDB
Position
Un
AA seq 348 aa
MAEMSFLSSEVLGGDFVSPFDQLGLGAEESLGLLDDNLEVAKHFKHHGFSCDKAKAGSSE
WLAVDWLVSDNSKEDAFSGTDWMVEKMDLKEFDFDILFSKDDLETMPDELLATLDDTCDL
FQPLVQETNKEPPQIVNPIGHLPEGLPTIDQGAPFTFFQPLPPSPGTLSSTPDHSFSLEL
CSEVVIPEGESKPDSTTTGFPQCIKEEDAPSDNDSGICMSPDSSLGSPQDSPSTSRGSPN
KSLLSPGALSGSSRPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQ
EALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKAREKKRVL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggccgagatgagctttctgagcagcgaggtgttagggggggacttcgtgtcccccttc
gaccagttgggtttgggggctgaagagagcctaggtctcctagatgacaacctggaggtg
gccaagcacttcaaacatcatgggttctcctgcgacaaggctaaggcaggctcctccgaa
tggctggctgtggattggttggtctcagacaacagcaaggaggatgctttctccgggaca
gattggatggtggagaaaatggatttgaaggagtttgattttgatatcctgttcagtaaa
gatgacctggaaaccatgccagatgagctcttggccacgttggatgacacgtgtgatctc
tttcagcccctagtccaggagactaacaaggagcccccccagatagtaaacccaattggc
catcttccagaaggtttaccaacaattgaccagggtgcccccttcactttctttcaacct
cttcccccttccccagggaccctgtcttccactccagatcattcctttagtttagagcta
tgcagtgaagtggttatccctgaaggagagagcaagccagactccaccactactgggttt
cctcaatgcataaaagaggaggatgccccctcagataatgatagtggcatctgtatgagc
cctgactcctctctgggctctccccaggatagcccttccacctccaggggctctccaaat
aagagcctgctatctccaggtgccctcagtggctcttcccgccccaaaccctacgaccct
cctggagagaagatggtagcagcaaaagtcaagggtgagaagctagacaagaagctgaag
aaaatggagcagaacaagacagcagctactaggtaccgccagaagaagagggcagaacag
gaggccctcactggtgaatgtaaagagctagaaaaaaagaatgaggctctgaaagagaag
gcagattccttggccaaggagatccagtatcttaaagatctgatagaagaggttcgcaaa
gcaagggagaagaaaagggtcctctag

KEGG   Bos mutus (wild yak): 102268154
Entry
102268154         CDS       T02919                                 

Gene name
CREB3L1
Definition
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102268154 (CREB3L1)
   04024 cAMP signaling pathway
    102268154 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    102268154 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    102268154 (CREB3L1)
   04152 AMPK signaling pathway
    102268154 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102268154 (CREB3L1)
   04922 Glucagon signaling pathway
    102268154 (CREB3L1)
   04915 Estrogen signaling pathway
    102268154 (CREB3L1)
   04926 Relaxin signaling pathway
    102268154 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    102268154 (CREB3L1)
   04918 Thyroid hormone synthesis
    102268154 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    102268154 (CREB3L1)
   04916 Melanogenesis
    102268154 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    102268154 (CREB3L1)
   04927 Cortisol synthesis and secretion
    102268154 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102268154 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102268154 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    102268154 (CREB3L1)
   04728 Dopaminergic synapse
    102268154 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    102268154 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102268154 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102268154 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102268154 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102268154 (CREB3L1)
   05020 Prion disease
    102268154 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    102268154 (CREB3L1)
   05031 Amphetamine addiction
    102268154 (CREB3L1)
   05034 Alcoholism
    102268154 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102268154 (CREB3L1)
   04934 Cushing syndrome
    102268154 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102268154 (CREB3L1)
   05161 Hepatitis B
    102268154 (CREB3L1)
   05163 Human cytomegalovirus infection
    102268154 (CREB3L1)
   05165 Human papillomavirus infection
    102268154 (CREB3L1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102268154 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Spc29 ELP6 Jnk-SapK_ap_N HAUS-augmin3 APG6_N TPR_MLP1_2 Prominin JMY RNase_Y_N ADIP DUF4404 DUF724
Other DBs
NCBI-GeneID: 102268154
NCBI-ProteinID: XP_005898973
UniProt: L8IG47
LinkDB
Position
Un
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPVVPIKMEDTTQDVEHGAWVLG
HKLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLTRLPVPHQAPGEMTQL
PVIKAEPQEVHQFLKVTPEDLLQMPPTPPSSHGSDSDGSQSPRSLPPSSPIRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLVAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTSK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMATDSVYAASQM
PSRSLLFYDEGAGSWEDGRSALLPVEPPDGWEIKPGGPVEQRPQDHLQHDHLDSTHETSK
YLSEAWPKDVGGNITGPDFSHPKEWFHERDLGPNTTVKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggagcccttcccggccgacaggctgtttcccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttccccgagcacctg
gaccactttgcagagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccctgtgctggacgagaagagccctctcctggacatggaactggactcccccacgccg
ggcatccaggccgagcacagctactccctgagcggtgactcggcgcctcagagccccgtc
gtgcccatcaagatggaagacaccacccaagatgtggaacatggagcgtgggtgctgggg
cacaaactgtgctcagtcatggtgaagcaggaacagagcccggagctgcccgtggaccct
ctggccgcctcctcggccatggccgccgccgctgccatggccaccaccccgctgctgggc
ctcagccccctgaccaggctgcccgtcccccaccaggccccaggagagatgactcagctg
ccagtgatcaaagccgagccccaggaggtgcaccagttcctcaaagtgacaccagaggac
ctgctgcagatgcctccgacgccccccagcagccacggcagcgacagcgacggctcccag
agtccccgctctctgcccccttccagcccaatccggcccatggcccgctcctccacggcc
atctccacctctccgctcctcaccgcccctcacaaattacaggggacgtcggggccgctg
ctcctgacggaggaggagaagcgcaccctggttgctgagggctatcccatccccaccaaa
ctccccctcacaaaagccgaggagaaggccttgaagagggtccggaggaagatcaagaac
aagatctcggcccaggagagccgccgtaagaagaaggaatacgtggagtgtctagaaaag
aaggtggagacatttacatctgagaacaacgaactgtggaagaaggtggaaacgctggag
aatgccaacaggactctgctccagcagctgcagaaactccagactctggtcaccagcaag
atctccagaccttacaagatggcagccacccagaccgggacctgcctcatggtggcagcc
ttgtgctttgtcctggtgctgggctccctcgtgccctgcctccctgagttctcctctggc
tcccagactgtgaaggaagacccgatggccactgacagcgtctacgccgccagtcagatg
ccctcccggagcctcctgttctacgacgagggagcaggctcgtgggaggatggccgcagt
gccctgctgcctgtggagccccccgatggctgggagatcaagcccggggggccggtggag
cagcgaccccaggaccacctgcaacatgaccacctggacagcacccacgagacgagcaag
tacctgagtgaggcctggccaaaggacgtcggtgggaacatcacgggtcctgacttctcc
caccctaaggagtggttccatgagagggatctgggtcccaacaccaccgtcaagctctcc
tag

KEGG   Bos mutus (wild yak): 102271999
Entry
102271999         CDS       T02919                                 

Gene name
CREB3L3
Definition
(RefSeq) cAMP responsive element binding protein 3 like 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102271999 (CREB3L3)
   04024 cAMP signaling pathway
    102271999 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    102271999 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    102271999 (CREB3L3)
   04152 AMPK signaling pathway
    102271999 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102271999 (CREB3L3)
   04922 Glucagon signaling pathway
    102271999 (CREB3L3)
   04915 Estrogen signaling pathway
    102271999 (CREB3L3)
   04926 Relaxin signaling pathway
    102271999 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    102271999 (CREB3L3)
   04918 Thyroid hormone synthesis
    102271999 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    102271999 (CREB3L3)
   04916 Melanogenesis
    102271999 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    102271999 (CREB3L3)
   04927 Cortisol synthesis and secretion
    102271999 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102271999 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102271999 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    102271999 (CREB3L3)
   04728 Dopaminergic synapse
    102271999 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    102271999 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    102271999 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102271999 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    102271999 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102271999 (CREB3L3)
   05020 Prion disease
    102271999 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    102271999 (CREB3L3)
   05031 Amphetamine addiction
    102271999 (CREB3L3)
   05034 Alcoholism
    102271999 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102271999 (CREB3L3)
   04934 Cushing syndrome
    102271999 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102271999 (CREB3L3)
   05161 Hepatitis B
    102271999 (CREB3L3)
   05163 Human cytomegalovirus infection
    102271999 (CREB3L3)
   05165 Human papillomavirus infection
    102271999 (CREB3L3)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102271999 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 ADIP ZapB DUF1664
Other DBs
NCBI-GeneID: 102271999
NCBI-ProteinID: XP_005896021
LinkDB
Position
Un
AA seq 456 aa
MDGDLAIGKMASSTSPMGPIDSLELLDLLFDRQDGVLRHVELGEDWGHGEDQVLPGADSD
DFLNSILGSGDSDSPTWSPAASDSGISEDLPSDTQDTPPHGGVPATPAGCHSVESGKGPC
PSYHPGPTCPARHLGPVAPRLETSVAIDLEMWSPGVYAEEQTDLADSPSRYNLTVKDLLL
SSSSGDLQQHHLAAPHLLRPGTGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERMLK
KIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKK
LQAIVVQSTSKSAQTGTCIAVLLFSFALIVLPSISPFASNRAESPGDFAPVRVFSRTLHN
DAASRVAPDTAPGSEAPGPGPNTGALQERSPGSPPGEWESQDTRALDNSTEDLDNSTLVQ
GNSVKELDRATLLDCAPPEPAVSPGHVGLEAAGGEL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggatggggacttagctattggaaagatggcttcctccaccagtcccatgggccctatc
gacagcctggaactcctggatctactgtttgaccggcaggatggcgtcctgagacacgta
gagctgggagaggactggggtcatggggaggaccaggtcctgccaggtgcggactctgat
gacttcctcaactccatcctgggttctggagattcagattccccaacctggtcccccgcg
gccagtgacagtggcatctcagaagatctgccctctgacacccaggacacgcctccacac
ggtggggtgcctgccacccctgccggctgccatagtgtggagtctggcaaggggccctgc
ccctcctaccatcctggccccacctgccctgccaggcacctcgggccagtggccccaagg
cttgagacttctgttgccatagacctggaaatgtggagcccaggcgtctatgctgaggag
cagaccgacctggctgactcgccctcacgctacaacctcacagtcaaggacctcctcctc
tccagcagcagcggggacctgcagcaacatcacctggcagccccccacctgttgcgacct
gggactgggcactgccaggagctggtgctgacggaggatgagaagaagctactagccaaa
gaaggcatcactctgcccactcagctgccccttaccaagtatgaggagcgaatgctgaaa
aagatccgccggaaaatccgaaacaaacagtcagctcaagaaagccggaaaaagaagaag
gaatacattgatggcctggagactcggatgtcagcttgtaccgcccagaatcaggaactt
cagaggaaggtcttgcatctcgaaaagcagaacctgtctctcttggaacagctgaagaaa
ctccaggccattgtggtccagtctaccagcaaatcggcacagacgggcacttgcatagca
gtcctgctcttctccttcgccctcatcgtcctcccctccatcagccctttcgcctccaac
agagccgagagccccggagacttcgcacctgtgcgagttttctccagaactctacacaac
gacgcggcatcccgggtggctcccgacactgcaccaggctccgaggcccccggacccggg
cccaacactggtgcacttcaggaaaggtctccaggcagccctccgggggaatgggaatcc
caggacacacgtgctctggacaactcgacagaggatctggacaactcaactctggtccag
ggcaactctgtgaaggaactggatcgggccaccctactggactgtgccccacctgagcca
gcagtcagcccgggccacgtggggctggaggcagcagggggggagctgtga

KEGG   Bos mutus (wild yak): 102275204
Entry
102275204         CDS       T02919                                 

Gene name
CREB5
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102275204 (CREB5)
   04024 cAMP signaling pathway
    102275204 (CREB5)
   04022 cGMP-PKG signaling pathway
    102275204 (CREB5)
   04151 PI3K-Akt signaling pathway
    102275204 (CREB5)
   04152 AMPK signaling pathway
    102275204 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102275204 (CREB5)
   04922 Glucagon signaling pathway
    102275204 (CREB5)
   04915 Estrogen signaling pathway
    102275204 (CREB5)
   04926 Relaxin signaling pathway
    102275204 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    102275204 (CREB5)
   04918 Thyroid hormone synthesis
    102275204 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    102275204 (CREB5)
   04925 Aldosterone synthesis and secretion
    102275204 (CREB5)
   04927 Cortisol synthesis and secretion
    102275204 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102275204 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102275204 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    102275204 (CREB5)
   04728 Dopaminergic synapse
    102275204 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    102275204 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    102275204 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102275204 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    102275204 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102275204 (CREB5)
   05020 Prion disease
    102275204 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    102275204 (CREB5)
   05031 Amphetamine addiction
    102275204 (CREB5)
   05034 Alcoholism
    102275204 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102275204 (CREB5)
   04934 Cushing syndrome
    102275204 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275204 (CREB5)
   05161 Hepatitis B
    102275204 (CREB5)
   05163 Human cytomegalovirus infection
    102275204 (CREB5)
   05165 Human papillomavirus infection
    102275204 (CREB5)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    102275204 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri Cnn_1N NDUFB11 DivIC
Other DBs
NCBI-GeneID: 102275204
NCBI-ProteinID: XP_005891489
LinkDB
Position
Un
AA seq 508 aa
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNPVGGAMAGPGAHQLGSA
RMPNHDTSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQTQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPTPACSQQQVIQHNTIT
TSSAVSEVVGSSTLSQLTTHRTDLNPIL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgatttatgaggaatccaagatgaatttggagcaggagaggccgtttgtctgcagtgcc
ccaggctgctcccagcgcttcccaacagaggatcatctgatgattcataggcacaagcat
gaaatgactttgaagtttccctcaataaaaacagacaatatgttatcagatcaaactcca
accccaacgagattcctgaagaactgcgaggaggtggggctctttagtgagttggactgc
tccctagagcatgagttcaggaaggctcaggaggaagagagcagcaagcggaatatctcg
atgcataaccctgttggtggggccatggcggggcctggagctcaccagctcggcagcgcc
cggatgcccaaccatgacaccagcgttgtgattcagcaagccatgccgtcaccccagtcc
agctctgtcatcacgcaggccccttccaccaaccgccagatcgggcctgtcccaggctct
ctatcttctctgctccatcttcacaacagacagagacagcccatgccagcctccatgcct
gggaccctgcccaaccctacaatgccgggctcttctgccgtcttgatgccaatggagaga
caaatgtcagtgaactccaacctcctgggaatgcaaggtccaaatctcagcaacccctgt
gcttctccccaagtccagccaatgcattcagaagctaagatgaggctgaaggctgcattg
actcaccaccctgctgccatgtcgaatgggaatatgaacaccatgggccacatgatggaa
atgatgggctcccggcaggaccagacgccacaccatcacatgcactcacacccgcatcag
caccagacactgccggcccaccacccctacccgcaccagcaccagcacccagcacaccac
cctcatcctcaaccccatcaccagcagaaccacccacatcatcactcccactcccacctt
catgcacacccagcacatcaccagacctcgccacacccacccctgcactccggcaaccaa
acacaggtttcaccagcaacacaacagatgcagcccacccagacaatacagccgccccag
cccacaggggggcgccggcgaagggtggtggatgaggatcctgacgagaggcggcggaaa
tttctggaaaggaaccgggcggccgccacccgctgcagacagaagaggaaggtctgggtg
atgtcactggaaaagaaagcagaagagctcacccagacaaacatgcagcttcagaacgaa
gtgtccatgttgaagaacgaggtggcacagctgaagcagctgttgttaacacataaagac
tgccccataacagccatgcagaaagaatcacaaggatatctcagtccagagagtagccct
cctgcaagtcccacccccgcatgctcgcagcagcaggtcatccagcataacaccatcacc
acttcctcggcagtcagcgaggtggtaggaagctccaccctcagccagctcaccactcac
agaacagacctgaaccccatcctctaa

KEGG   Bos mutus (wild yak): 102277321
Entry
102277321         CDS       T02919                                 

Gene name
CREB3
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102277321 (CREB3)
   04024 cAMP signaling pathway
    102277321 (CREB3)
   04022 cGMP-PKG signaling pathway
    102277321 (CREB3)
   04151 PI3K-Akt signaling pathway
    102277321 (CREB3)
   04152 AMPK signaling pathway
    102277321 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102277321 (CREB3)
   04922 Glucagon signaling pathway
    102277321 (CREB3)
   04915 Estrogen signaling pathway
    102277321 (CREB3)
   04926 Relaxin signaling pathway
    102277321 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    102277321 (CREB3)
   04918 Thyroid hormone synthesis
    102277321 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    102277321 (CREB3)
   04916 Melanogenesis
    102277321 (CREB3)
   04925 Aldosterone synthesis and secretion
    102277321 (CREB3)
   04927 Cortisol synthesis and secretion
    102277321 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102277321 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102277321 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    102277321 (CREB3)
   04728 Dopaminergic synapse
    102277321 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    102277321 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    102277321 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102277321 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    102277321 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102277321 (CREB3)
   05020 Prion disease
    102277321 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    102277321 (CREB3)
   05031 Amphetamine addiction
    102277321 (CREB3)
   05034 Alcoholism
    102277321 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102277321 (CREB3)
   04934 Cushing syndrome
    102277321 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102277321 (CREB3)
   05161 Hepatitis B
    102277321 (CREB3)
   05163 Human cytomegalovirus infection
    102277321 (CREB3)
   05165 Human papillomavirus infection
    102277321 (CREB3)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102277321 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 102277321
NCBI-ProteinID: XP_005900840
UniProt: L8IC94
LinkDB
Position
Un
AA seq 376 aa
MSHMELALDPGDHDLLGFLLEESGGLGAAPDEALTSPPDWELPLSEPVNLNPVQSLSDWD
VEDFLSCLPSPPAVLNVFSSSDPCLVQHDHTYSLSQEHVSIDLDNESYEKEGAQMTPLLV
EEPADQEIARLILTEEEKRLLEKEGLTLPGMLPLTKMEEQVLKRVRRKIRNKKSAQESRR
KKKVYVGGLESRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAMVIQTANKASSSST
CVLVLLFSFCLLLVPAMYSSDTRGSLPAEHRVLSRQLRALPSEDPPQLEPPALQSEVPKD
SLDPELQAASNSCCLFHLMPQAPRAEPPLQLPLPDGFSGCSCPDSISPLHANLTREEGWL
PTPSPTSVILQGRYSG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtctcatatggagctggcgttggacccgggtgaccacgacctgctaggctttctgcta
gaagaaagcggtggtttgggtgcggcgcccgacgaggccttgacgtctccgccggattgg
gagctgccactttctgagcctgttaatttgaaccctgtgcagtctctgagcgactgggac
gtggaggatttcctgagctgcctgccgagtcccccagcagtgttgaacgttttcagcagc
tctgacccctgtcttgtccagcatgaccacacctattctctgtcacaagagcatgtctcc
atagatctcgataatgagagctatgaaaaagagggggctcagatgactccactgcttgtg
gaggagccggcagatcaggagattgctaggctgatactgactgaggaggagaaaaggctg
ttggagaaggaggggcttactttgcctgggatgcttccgctcactaagatggaggaacaa
gttctgaaacgggtgcggaggaagattcgaaacaaaaagtctgctcaagagagccgcagg
aagaagaaggtgtatgtggggggtttagaaagcagggtcctgaaatacacagcccagaat
ctggagctacagaacaaagtacagctcctggaggaacagaatctgtcccttttggatcag
ctgaggagactccaggccatggtgattcagacagcaaacaaagccagcagcagcagcacc
tgtgtcttggttctactcttctccttctgtctcctcctcgtacctgctatgtactcctcg
gacacaagggggagcctgccggctgagcacagagtgttgtcccgtcagcttcgtgccctc
cccagcgaggaccccccgcagctggagccacctgccctgcagtcagaggtaccaaaggac
agcttggaccctgagctccaggctgctagcaactcttgctgcctcttccatctcatgccc
caggctcctagagcagagcctcccctgcaattgccactgcctgatggtttctcagggtgc
tcctgcccagattccatatctcccctgcatgcaaatctcacaagagaggaaggatggctc
cctactcccagccccacatctgttatcttgcagggcagatactcaggctag

KEGG   Bos mutus (wild yak): 102281505
Entry
102281505         CDS       T02919                                 

Gene name
CREB3L4
Definition
(RefSeq) cAMP responsive element binding protein 3 like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102281505 (CREB3L4)
   04024 cAMP signaling pathway
    102281505 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    102281505 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    102281505 (CREB3L4)
   04152 AMPK signaling pathway
    102281505 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102281505 (CREB3L4)
   04922 Glucagon signaling pathway
    102281505 (CREB3L4)
   04915 Estrogen signaling pathway
    102281505 (CREB3L4)
   04926 Relaxin signaling pathway
    102281505 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    102281505 (CREB3L4)
   04918 Thyroid hormone synthesis
    102281505 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    102281505 (CREB3L4)
   04916 Melanogenesis
    102281505 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    102281505 (CREB3L4)
   04927 Cortisol synthesis and secretion
    102281505 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102281505 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102281505 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    102281505 (CREB3L4)
   04728 Dopaminergic synapse
    102281505 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    102281505 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    102281505 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102281505 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    102281505 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102281505 (CREB3L4)
   05020 Prion disease
    102281505 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    102281505 (CREB3L4)
   05031 Amphetamine addiction
    102281505 (CREB3L4)
   05034 Alcoholism
    102281505 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102281505 (CREB3L4)
   04934 Cushing syndrome
    102281505 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102281505 (CREB3L4)
   05161 Hepatitis B
    102281505 (CREB3L4)
   05163 Human cytomegalovirus infection
    102281505 (CREB3L4)
   05165 Human papillomavirus infection
    102281505 (CREB3L4)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102281505 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB HAUS-augmin3 OppC_N EMP24_GP25L DUF724
Other DBs
NCBI-GeneID: 102281505
NCBI-ProteinID: XP_005910088
LinkDB
Position
Un
AA seq 425 aa
MRDPGRKKRCTVWGHQRARLAWQDWALRNSRTMDFKTPDLLDMCLEPPEDVFSTGSFLEL
GLQGLPSEVPVTRLQEQGLQGWECSVGHGCGLQESEPEDFLKLFIDPNQVYCSEASPGSD
SGISEDPGHPDSPPAPKPPSSPALYEVVYEAGTLERMQGEAGPAVGLISIQLDQWSTPFT
VPDACVVSELPPDAHILPTAATVNSAPPAALLPCQTLFLTEEEKRLLGQEGVSLPSHLPL
TKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACAAQNQELQRKVQELERHN
ISLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLALIILPSFSPFQGLPEAGPEDYQPH
GVISRNILTHRDMTENPENAVEESRLEGPPGAKGANSSTRTPLEKVGGMAGPSRHIRTVL
HADEM
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcgagatcctggaagaaagaaaaggtgtactgtttggggccatcaacgagctaggctg
gcttggcaggactgggctcttcgaaacagcagaaccatggatttcaaaacccctgacctg
ctggacatgtgtctggaacctccagaagatgtcttctcaacaggatctttcctggagctg
ggactccaaggtctaccttcagaggttccagtgactaggctacaggaacaggggctgcaa
ggctgggagtgcagtgtgggccacggctgtggtcttcaagagagtgagcctgaagatttc
ctgaaacttttcattgaccccaatcaagtttactgctcagaagcatctcctggcagtgac
agtggaatctctgaggatcccggccatccagacagtccccctgcccccaagccacccagt
tcccctgccctctatgaggttgtctatgaggcagggaccctggagaggatgcagggggaa
gccgggccagctgtagggctcatctccatccagctagatcagtggagcacgccatttaca
gtgcctgatgcctgcgtggtcagtgagctgcctcctgatgctcacatcctgcccacggca
gctactgtaaactcagcgcctcccgcagccctgctgccctgtcaaaccttgttcctgaca
gaagaggagaagcggctgctgggacaggaaggggtttccctaccctctcacctgcccctc
accaaggcagaggagagggttctcaagaaggtcagaaggaaaatccgtaataagcagtca
gctcaggatagccggcggcggaaaaaggagtacattgatggcctagagagcagggtggct
gcctgtgctgcacagaaccaggaactacagagaaaagtccaggagctagagaggcacaac
atctccctggtgactcagctccgccagctgcagatgcttattgttcaaacctccaacaaa
gctgcccagactagcacttgtgttctgatccttcttttctccttggctctcatcatcttg
cccagcttcagcccctttcagggcctgccagaagctgggcctgaggattaccagcctcat
ggagtgatttccagaaacatcctgactcacagggacatgacagagaatcctgaaaacgca
gtggaagagtccagactggagggaccacctggggccaagggtgcaaacagctccacaagg
acaccgcttgagaaggtgggagggatggcaggccccagcaggcacatcagaactgtgtta
catgcagacgaaatgtga

KEGG   Bos mutus (wild yak): 102281756
Entry
102281756         CDS       T02919                                 

Gene name
CREB1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04380  Osteoclast differentiation
bom04612  Antigen processing and presentation
bom04668  TNF signaling pathway
bom04710  Circadian rhythm
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04931  Insulin resistance
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom05016  Huntington disease
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05203  Viral carcinogenesis
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102281756 (CREB1)
   04024 cAMP signaling pathway
    102281756 (CREB1)
   04022 cGMP-PKG signaling pathway
    102281756 (CREB1)
   04151 PI3K-Akt signaling pathway
    102281756 (CREB1)
   04152 AMPK signaling pathway
    102281756 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102281756 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    102281756 (CREB1)
   04922 Glucagon signaling pathway
    102281756 (CREB1)
   04915 Estrogen signaling pathway
    102281756 (CREB1)
   04926 Relaxin signaling pathway
    102281756 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    102281756 (CREB1)
   04918 Thyroid hormone synthesis
    102281756 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102281756 (CREB1)
   04916 Melanogenesis
    102281756 (CREB1)
   04924 Renin secretion
    102281756 (CREB1)
   04925 Aldosterone synthesis and secretion
    102281756 (CREB1)
   04927 Cortisol synthesis and secretion
    102281756 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102281756 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102281756 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    102281756 (CREB1)
   04728 Dopaminergic synapse
    102281756 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102281756 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    102281756 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    102281756 (CREB1)
   04713 Circadian entrainment
    102281756 (CREB1)
   04714 Thermogenesis
    102281756 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102281756 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102281756 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102281756 (CREB1)
   05020 Prion disease
    102281756 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    102281756 (CREB1)
   05031 Amphetamine addiction
    102281756 (CREB1)
   05034 Alcoholism
    102281756 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102281756 (CREB1)
   04934 Cushing syndrome
    102281756 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102281756 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102281756 (CREB1)
   05161 Hepatitis B
    102281756 (CREB1)
   05163 Human cytomegalovirus infection
    102281756 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281756 (CREB1)
   05165 Human papillomavirus infection
    102281756 (CREB1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102281756 (CREB1)
Mitochondrial biogenesis [BR:bom03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    102281756 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 102281756
NCBI-ProteinID: XP_005907095
UniProt: L8HUZ8
LinkDB
Position
Un
AA seq 341 aa
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaagccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaaccgat
tcccaaaaacgaagagagattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaaatctgaagaggagact
tcagcacctgccatcaccactgtcacggtgccaactccgatttatcagactagcagtgga
cagtatattgccattacccaaggaggagcaatacaactggctaacaatggtactgatggg
gtacagggcctgcagacattaaccatgaccaatgcagctgccactcagccaggtactacc
atcctgcagtatgcacagaccactgatggacagcaaatcctagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacagacataccagattcgcacagcgcccactagc
accattgcccctggagttgttatggcgtcttccccagcacttcctacacagcctgctgaa
gaagcggcgcgaaagagagaggttcgcctcatgaagaacagggaagcagcacgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtctagaaaacagagtggcagtgcttgaaaat
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Bos mutus (wild yak): 102283891
Entry
102283891         CDS       T02919                                 

Gene name
ATF2
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04714  Thermogenesis
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04918  Thyroid hormone synthesis
bom04922  Glucagon signaling pathway
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102283891 (ATF2)
   04668 TNF signaling pathway
    102283891 (ATF2)
   04022 cGMP-PKG signaling pathway
    102283891 (ATF2)
   04151 PI3K-Akt signaling pathway
    102283891 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102283891 (ATF2)
   04922 Glucagon signaling pathway
    102283891 (ATF2)
   04915 Estrogen signaling pathway
    102283891 (ATF2)
   04926 Relaxin signaling pathway
    102283891 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    102283891 (ATF2)
   04918 Thyroid hormone synthesis
    102283891 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    102283891 (ATF2)
   04925 Aldosterone synthesis and secretion
    102283891 (ATF2)
   04927 Cortisol synthesis and secretion
    102283891 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102283891 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    102283891 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    102283891 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102283891 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102283891 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    102283891 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    102283891 (ATF2)
   05031 Amphetamine addiction
    102283891 (ATF2)
   05034 Alcoholism
    102283891 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102283891 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102283891 (ATF2)
   05161 Hepatitis B
    102283891 (ATF2)
   05163 Human cytomegalovirus infection
    102283891 (ATF2)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    102283891 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 102283891
NCBI-ProteinID: XP_005902607
UniProt: L8I4M8
LinkDB
Position
Un
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHSS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTTGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPVLSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtaaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccgtttctatgtactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgagttcaagaaagcctca
gaagatgacattaaaaaaatgcctctagatttatctcctcttgcaacacccatcataaga
agcaaaattgaggagccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgagaaggaagtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatctttacaagttcccaatgtgctgcttacaagttctgac
tcaagtgtcattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccgtcctccaacaggccaattgttcctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaatcacaagttctaatgtg
catgttccagctgcagttccacttgttcgaccagtcaccatggtgcctagcgttccagga
attccaggtccttcctctcctcaaccagtgcagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaacggcgatactgtcaaaggtcacagtagt
ggtttggttaggactcaatcagaggaatctcgaccacagtcattacaacagccagccaca
tccaccacagaaacaccggcttctccagctcacacaactccacagacccaaaatacaact
ggtcgtcgaagaagagcagctaatgaagatcccgatgaaaaaaggaggaagtttctggaa
agaaatagagcagcagcttcaagatgccgacaaaagagaaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagacgatagttcagaagat
ttgtcagtgccgagtagtccacataccgaagctatacaacatagttctgtcagcacatcc
aatggagtcagttcaacttccaaggcagaagctgtagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgtgctttcgcagattgtcatggctccttcctcccagtca
cagccctcaggaagttga

KEGG   Bos mutus (wild yak): 102288212
Entry
102288212         CDS       T02919                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04022  cGMP-PKG signaling pathway
bom04141  Protein processing in endoplasmic reticulum
bom04151  PI3K-Akt signaling pathway
bom04211  Longevity regulating pathway
bom04261  Adrenergic signaling in cardiomyocytes
bom04668  TNF signaling pathway
bom04728  Dopaminergic synapse
bom04911  Insulin secretion
bom04915  Estrogen signaling pathway
bom04918  Thyroid hormone synthesis
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom05020  Prion disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102288212 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102288212 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102288212 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102288212 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102288212 (ATF6B)
   04915 Estrogen signaling pathway
    102288212 (ATF6B)
   04926 Relaxin signaling pathway
    102288212 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102288212 (ATF6B)
   04918 Thyroid hormone synthesis
    102288212 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102288212 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102288212 (ATF6B)
   04927 Cortisol synthesis and secretion
    102288212 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102288212 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102288212 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102288212 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102288212 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102288212 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102288212 (ATF6B)
   05031 Amphetamine addiction
    102288212 (ATF6B)
   05034 Alcoholism
    102288212 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102288212 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102288212 (ATF6B)
   05161 Hepatitis B
    102288212 (ATF6B)
   05163 Human cytomegalovirus infection
    102288212 (ATF6B)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102288212 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 102288212
NCBI-ProteinID: XP_005901676
LinkDB
Position
Un
AA seq 710 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGAQNSTLYAGLDEVAEEQTELFRCPEQDVPFGS
SSLDLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSNQAPGVGE
MLVVKSESLAPPLCLLGDDPTSPFETIQINVSTTSDDPSDIQIKIEPASPSSSINSEAPL
LSAESPSQAFIGEEVLEVKTESPSPQGCLLRDVPGPSPGAVQISMGLSSDGSSGKALPAR
KPPLQPKPMLITTVPIPPRAVPASTTVLLQPLVQPPPVSPVVLIQGTVRVQPEGPTPPPP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNREAACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFIAFNFGPVSISEPP
PASISPRMSRGESRPRRHLLEFSAQEPVHGAEPRQHPFQDPEEPQPSPAGHPSFRNLTAF
PGDTRELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKTPQRAQEKQKS
QLRKKSPPVQAVPTRPPGPPEGDSVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSSTPGNATGGPLPASAAASQAHQAAHQPSTSIISDLYDSH
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggcggagctgatgcttctcagcgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactggggtgcgcagaacagcactttgtacgccggcttggatgaa
gtggccgaggagcagacggagctcttccgttgtccggagcaagatgtcccgtttggcagc
agctctctggacctgggaatggacgtcagccctcctgaacccccctgggactctctgcct
atcttcccagatctccaggtgaagtctgagccatcctccccctgctcttcctcctccctc
agctctgaatcatcgcatctttccacagagccctccaaccaggcccctggtgtaggggag
atgctggttgtgaagtcagagtccttggcacccccactctgcctcctgggagatgatcca
acatccccatttgaaaccatccagatcaatgtcagcaccacctctgatgatccttcagat
attcagattaagatagagcctgcctctccatcttcctccatcaactcggaggctcccctg
ctctctgcagagtcccccagccaggctttcataggagaggaggtcctggaagtgaagaca
gagtccccgtcccctcaggggtgtctcctgcgggatgtccccggcccctctcctggagct
gtccagatcagcatgggcctgtcctctgacggctcctcaggcaaagccctgcctgcccgg
aagccaccactgcagcccaaacccatgctgataaccactgtcccgatacccccgagagct
gtgcctgccagcaccaccgtcctcttgcagcctcttgtccagccacccccagtgtcccca
gttgtcctcatccaaggtactgttcgagtccagcctgagggaccgacccctcctcctcca
cggcctgagaggaagagcattgttccagcccctatgcctgggaactcctgccctcctgag
gtggatgccaagctgctgaagcggcagcagcggatgatcaagaaccgggaggcagcctgc
cagtcccgcaggaagaagaaagagtacctgcaggggctggaagcccggctgcaggccgtg
ctggccgacaaccagcagctccggcgggagaatgctgccctccgccggcggctggaggcc
ctgctgactgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcgtc
atggtcttccttctcttcatcgctttcaactttgggcctgtgagcatcagtgagcctcct
ccggcttccatctctcctcggatgagcagaggggagtctcgaccccggagacacttgctg
gagttctcggcacaagagccagttcatggagccgagccccgccagcatcccttccaggac
cctgaggagccccagcccagccccgctggccacccaagtttcaggaacctgacagccttc
cctggggacaccagggagctgctgctgagagacctggaccagctcttcctctcctcggat
tgccggcactttaaccgaaccgagtccctgaggcttgctgacgagctgagtggctgggtc
cagcgccaccagagaggccggcggaagacacctcagagagcccaggagaaacagaagtct
cagttgcggaagaagtctcctccagttcaggcagtccctacccgcccccctgggcccccg
gaaggggattccgtgggccagctgcagctgtaccgccaaccagaccgttcgcagcccgag
ttcctggatgcaattgaccgacgggaagacacattttacgttgtctccttccgaagggac
cacttgctgctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtg
atgcctgctatggcccccaatgagaccctatcaggccggggaccccctggggactatgag
gagatgatgcagatcgagtgtgaggtcatggatacgagggtgattcacatcaagacctcc
acagtgcccccctcgctacgaaaacagccgtcctcaaccccgggcaatgccacgggtggc
cccttgccagcttctgcagcagccagccaggctcaccaggctgcccatcagccctctacc
tcaatcatctctgacctctatgactcacactga

DBGET integrated database retrieval system