KEGG   Bos mutus (wild yak): 102264698Help
Entry
102264698         CDS       T02919                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00480  Glutathione metabolism
bom00980  Metabolism of xenobiotics by cytochrome P450
bom00982  Drug metabolism - cytochrome P450
bom00983  Drug metabolism - other enzymes
bom01100  Metabolic pathways
bom01524  Platinum drug resistance
bom05200  Pathways in cancer
bom05204  Chemical carcinogenesis
bom05225  Hepatocellular carcinoma
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102264698
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102264698
   00982 Drug metabolism - cytochrome P450
    102264698
   00983 Drug metabolism - other enzymes
    102264698
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102264698
   05204 Chemical carcinogenesis
    102264698
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102264698
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102264698
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102264698
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bom02000]
    102264698
Enzymes [BR:bom01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102264698
Transporters [BR:bom02000]
 Other Transporters
  Pores ion channels [TC:1]
   102264698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin Corona_S2
Motif
Other DBs
NCBI-GeneID: 102264698
NCBI-ProteinID: XP_005903764
UniProt: L8I399
LinkDB All DBs
Position
Un
AA seq 241 aa AA seqDB search
MSGGTVRSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLRAKGIRHEVININLKNKP
EWFFKKNPLGLVPVLETSLGQLIYESAITCEYLDEAYPEKKLLPGDPYEKACQKMVLESF
SKVPSLMVSFLRKQNKEDCSGLKEELHKEFSKLEEVLTNKKTTFFGGSSLSMIDYLIWPW
FEWLEALELNECVDHTPNLKLWMASMKNDPIVSSLPTDVKTLQGFFNLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcggaacggtcagaagcctggggaagggaagcgcgcccccagggcccgtcccc
gaaggcctgatccgtgtctacagcatgaggttctgtccttacgccaagaggacgctcctg
gtcctgagggccaagggaatccggcatgaagtcatcaacataaatctgaaaaataagcct
gagtggtttttcaagaagaatcccttaggcctagtgccggttctggaaaccagtctgggt
cagttgatctatgaatctgccatcacttgtgagtacctggatgaagcatatccagagaag
aagctgttgccaggcgacccctatgagaaagcttgccaaaagatggtcttggagtccttt
tctaaggtaccatctttgatggtaagctttcttagaaagcaaaataaggaagattgctct
ggcctaaaagaagaactgcataaagaattcagcaagctggaggaggttctgactaataag
aagacaaccttctttggtggcagttctctttctatgattgattacctcatctggccctgg
tttgaatggctagaagccttggagttaaatgagtgtgtagaccacactccaaatctaaag
ctctggatggcatccatgaagaatgatcccatagtatcatccctccccaccgatgtgaag
acccttcaaggtttcttcaacctctacttacagaacagccccgaggcctgtgactatggt
ctctga

DBGET integrated database retrieval system