KEGG   Bos mutus (wild yak): 102264754
Entry
102264754         CDS       T02919                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102264754 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bom04030]
    102264754 (PTGDR)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    102264754 (PTGDR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 102264754
NCBI-ProteinID: XP_005894603
UniProt: L8IMD1
LinkDB
Position
Un
AA seq 361 aa
MGPLFYRCHNTTSVEKGNSATMGGVLFSTGLVGNLLALGLLARSGLGSCPPRSPRPPPSV
FYVLVFGLTITDLLGKCLVSPFVLSAYAQNRSLRELVPGSDSSLCQAFAFIMSFFGLAST
LQLLAMALECWLSLGHPFFHRQHLTPRRGAMVAPVVGAFCLAFCALPLVGFGKFVQYCPG
TWCFFQMVHEERSLSVLSYSVLYASLMLLLVLAIVLCNLSAMRNLYAMHLRLRGLLRPGS
RERAEPGPGEREATPLHLEELDHLLLLALMTVLFTMCSLPLIYRAYYGAFKAVPEQNGTT
EETEDLRALRFLSVISIVDPWIFIIFRTSVFRMFFRKIFIRPLIHRNWHSNSCQTNMESS
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggggccgctgttttaccgctgccacaacaccacgtcggtggagaagggcaattcggcg
acgatgggcggggtgctcttcagcacgggcctcgtgggcaacctgctggccctgggactc
ctggcgcgctccggtctggggtcgtgcccgccgcgctcgccgcgcccgccgccctccgtc
ttctacgtgctggtgttcggcctgacgatcacagacctcctgggcaagtgtctagtgagc
cccttcgtgctgtccgcctacgcgcagaaccggagcctgcgggagctggtgcccggatcg
gacagctctctgtgccaagccttcgccttcatcatgtccttcttcgggctcgcctcgacg
ctgcagctgctggccatggccctggagtgctggctctccctggggcaccccttcttccat
cgacagcacctcaccccgcgccggggtgcaatggtggcgccggtggtgggcgccttctgc
ctcgctttctgcgcgctgcccttggtgggctttgggaagtttgtgcagtactgccctggc
acctggtgcttcttccagatggttcacgaggagcgctcgctgtcggtgctgagctactcg
gtgctctacgccagcctcatgctgctgctggtgctcgccatcgtgctgtgcaacctgagc
gccatgcgcaacctctatgccatgcacctgcggctgcggggactcctgcgccctggctcc
agggaacgcgccgagccgggccccggcgagagggaggccaccccgctgcacctggaggag
ctggatcacctcctgctgctagccctcatgacggtgctcttcaccatgtgctccctgcct
ttaatttatcgtgcttactatggagcgtttaaagctgttcctgagcaaaatggaaccact
gaagaaactgaagacctccgagccttgcgctttctctctgtgatctcaattgtggaccct
tggattttcatcattttcagaacatcagtgtttcgaatgttttttcgcaagattttcata
aggccccttatacatagaaattggcacagcaattcttgccaaactaacatggaatccagt
ctataa

DBGET integrated database retrieval system