KEGG   Bos mutus (wild yak): 102264800
Entry
102264800         CDS       T02919                                 

Gene name
IL11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102264800 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102264800 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102264800 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102264800 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102264800 (IL11)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102264800 (IL11)
SSDB
Motif
Pfam: IL11 DUF4349
Other DBs
NCBI-GeneID: 102264800
NCBI-ProteinID: XP_014337053
LinkDB
Position
Un
AA seq 128 aa
MGRRGRSEQGLRGAQGAWLPGVLTRLRADLFSYLRHVQWLRRSGGPSLRTLEPELGTLQA
RLDRLLRRLQLLMSRLALPQVPPDPPAPPLAPPASAWGGIRAAHAILGGLQLTLDWAVRG
LLLLKTRL
NT seq 387 nt   +upstreamnt  +downstreamnt
atggggaggcggggacgcagcgagcagggccttcggggcgcgcagggggcctggctcccg
ggagtgttgacacggctgcgggcagacctgttctcctacctgaggcatgtgcagtggctg
cgacgttcaggaggcccttccctgcggaccctggagcccgagctgggcaccctgcaggcc
cggctggaccggctgctgcgccggctgcagctcctgatgtcccgcctggccctgccccag
gtacccccagaccctccggcaccccccctggcacccccggcctcagcctgggggggcatc
cgggcggcccatgccatcctgggggggctgcagctgacgctcgactgggccgtgcggggc
ctgctgctgctgaagactcggctgtga

KEGG   Bos mutus (wild yak): 102266354
Entry
102266354         CDS       T02919                                 

Definition
(RefSeq) interferon alpha-1
  KO
K05414  interferon alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102266354
   04151 PI3K-Akt signaling pathway
    102266354
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102266354
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102266354
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102266354
   04621 NOD-like receptor signaling pathway
    102266354
   04622 RIG-I-like receptor signaling pathway
    102266354
   04623 Cytosolic DNA-sensing pathway
    102266354
   04650 Natural killer cell mediated cytotoxicity
    102266354
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102266354
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102266354
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102266354
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102266354
   05161 Hepatitis B
    102266354
   05160 Hepatitis C
    102266354
   05171 Coronavirus disease - COVID-19
    102266354
   05164 Influenza A
    102266354
   05162 Measles
    102266354
   05168 Herpes simplex virus 1 infection
    102266354
   05163 Human cytomegalovirus infection
    102266354
   05167 Kaposi sarcoma-associated herpesvirus infection
    102266354
   05169 Epstein-Barr virus infection
    102266354
   05165 Human papillomavirus infection
    102266354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102266354
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102266354
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102266354
NCBI-ProteinID: XP_005910752
UniProt: L8HN86
LinkDB
Position
Un
AA seq 189 aa
MAPAWPLLLALLLLSCNTICSLGCHQPHSHSLANRRVLTLLRQLRRVSPSSCLQDRNDFT
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSATMWDESLLDKLRTALDQQLTDLQ
ACLRQEEELQGAPLLKEDSSLAVRKYFHRLTVYLQEKRHSPCAWEVVRAQVMRAFSSSTN
LQESFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggcccctcctcctagctctgctgctgctcagctgcaacaccatctgc
tctctgggctgccaccagcctcactcccacagcctggccaacaggagagtcctgacactc
ctgagacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcaca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagcttttcagcacagagggctcggccaccatgtgg
gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggagctgcaaggagctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactgtctatctgcaagagaagagacacagc
ccttgtgcctgggaggttgtcagagcacaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagtttcaggagaaaggactga

KEGG   Bos mutus (wild yak): 102266530
Entry
102266530         CDS       T02919                                 

Gene name
IL22
Definition
(RefSeq) interleukin 22
  KO
K05445  interleukin 22
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102266530 (IL22)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102266530 (IL22)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102266530 (IL22)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    102266530 (IL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102266530 (IL22)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102266530 (IL22)
SSDB
Motif
Pfam: IL22 IL10 FlaC_arch
Other DBs
NCBI-GeneID: 102266530
NCBI-ProteinID: XP_005909109
UniProt: L8HUC1
LinkDB
Position
Un
AA seq 190 aa
MAALQKSVGSPLRDTLATGCLLVMVLCAQGGAAAPITSHCRLNESDFQEPYIFNHTFTLA
QEASLADNITDVRLIGNKLFHGIHQVTKRCYVLKQVLNFILEEVLFPQSDKFHPYMGKVV
PFFSRLSKKLSQCHVESDNQHIQRNVQNLKNTVKKLGESGEIKVIGELNLLFTTLKRECA
QVDQGWKMGY
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctgccctgcagaaatctgtgggctctcctctcagggacactctggccactggctgc
ctccttgtcatggtgctgtgcgcccagggaggagcggctgcacccatcacgtcgcactgt
aggctcaacgagtccgacttccaggagccctacatcttcaaccacaccttcactctggct
caggaggctagtttggcagataacatcacagatgttcgtctcattgggaacaaattgttc
cacggaatccatcaggtgacgaagcgctgctacgtgctgaagcaggtgctgaactttatt
cttgaagaggtgctgttcccccaatccgacaaattccacccctatatgggaaaggtggtg
cccttcttctccaggctcagcaaaaagctaagccaatgtcatgttgagtctgacaaccag
cacatccagagaaatgtacagaatctgaagaacacagtgaaaaagcttggagagagtgga
gagattaaagtcattggagaactgaacttgctgtttacaaccctgaaacgtgaatgtgct
caagtagaccaaggctggaaaatgggttactaa

KEGG   Bos mutus (wild yak): 102266753
Entry
102266753         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102266753
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102266753
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102266753
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102266753
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102266753
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 102266753
NCBI-ProteinID: XP_005898514
UniProt: L8ID84
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLVGRQNLRLLGQMRRLSPRFCLQERKHFA
YPQEMVEGSQLHEAQAISVLHEMLQQSFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGPVTGEEDSALGRMGPTLAVKKYFQGIHVYLKEKEYSDCAWEIVIVEIMRSLSSSAN
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctatggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctctcctcgcttctgtctgcaggaaagaaaacacttcgct
tacccccaggagatggtggagggcagccagctccatgaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcttgggcccagtgacgggagaggaagactctgccctgggaaggatgggccccaca
ctggccgtgaagaagtacttccagggcatccatgtctacctgaaagagaaggaatacagt
gactgcgcctgggaaatcgtcatagtggaaatcatgagatccttgtcttcatcagccaac
ttgcaagaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102267095
Entry
102267095         CDS       T02919                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
bom  Bos mutus (wild yak)
Pathway
bom03050  Proteasome
bom04060  Cytokine-cytokine receptor interaction
bom04066  HIF-1 signaling pathway
bom04217  Necroptosis
bom04350  TGF-beta signaling pathway
bom04380  Osteoclast differentiation
bom04612  Antigen processing and presentation
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04940  Type I diabetes mellitus
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05143  African trypanosomiasis
bom05144  Malaria
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05164  Influenza A
bom05168  Herpes simplex virus 1 infection
bom05200  Pathways in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
bom05322  Systemic lupus erythematosus
bom05323  Rheumatoid arthritis
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    102267095 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102267095 (IFNG)
   04630 JAK-STAT signaling pathway
    102267095 (IFNG)
   04066 HIF-1 signaling pathway
    102267095 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102267095 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102267095 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102267095 (IFNG)
   04612 Antigen processing and presentation
    102267095 (IFNG)
   04660 T cell receptor signaling pathway
    102267095 (IFNG)
   04658 Th1 and Th2 cell differentiation
    102267095 (IFNG)
   04659 Th17 cell differentiation
    102267095 (IFNG)
   04657 IL-17 signaling pathway
    102267095 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102267095 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267095 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102267095 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102267095 (IFNG)
   05323 Rheumatoid arthritis
    102267095 (IFNG)
   05321 Inflammatory bowel disease
    102267095 (IFNG)
   05330 Allograft rejection
    102267095 (IFNG)
   05332 Graft-versus-host disease
    102267095 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102267095 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102267095 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102267095 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102267095 (IFNG)
   05164 Influenza A
    102267095 (IFNG)
   05168 Herpes simplex virus 1 infection
    102267095 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102267095 (IFNG)
   05144 Malaria
    102267095 (IFNG)
   05145 Toxoplasmosis
    102267095 (IFNG)
   05140 Leishmaniasis
    102267095 (IFNG)
   05142 Chagas disease
    102267095 (IFNG)
   05143 African trypanosomiasis
    102267095 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:bom03051]
    102267095 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102267095 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102267095 (IFNG)
Proteasome [BR:bom03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102267095 (IFNG)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102267095 (IFNG)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102267095 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 DnaGprimase_HBD PRANC Cep57_MT_bd Spore_III_AB
Other DBs
NCBI-GeneID: 102267095
NCBI-ProteinID: XP_005909111
UniProt: L8HQQ5
LinkDB
Position
Un
AA seq 166 aa
MKYTSYFLALLLCVLLGFSGSYGQGQFFREIENLKEYFNASNPDVAKGGPLFSEILKNWK
DESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ
IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagctatttcttagctttactgctctgtgtgcttttgggtttttctggt
tcttatggccagggccaattttttagagaaatagaaaacttaaaggagtattttaatgca
agtaacccagatgtagctaagggtgggcctctcttctcagaaattttgaagaattggaaa
gatgaaagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt
gaaaacctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg
tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa
attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg
aatgacctgtcgccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga
ggccggagagcatcaatgtaa

KEGG   Bos mutus (wild yak): 102267307
Entry
102267307         CDS       T02919                                 

Definition
(RefSeq) interferon alpha-B
  KO
K05414  interferon alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102267307
   04151 PI3K-Akt signaling pathway
    102267307
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102267307
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102267307
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102267307
   04621 NOD-like receptor signaling pathway
    102267307
   04622 RIG-I-like receptor signaling pathway
    102267307
   04623 Cytosolic DNA-sensing pathway
    102267307
   04650 Natural killer cell mediated cytotoxicity
    102267307
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267307
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102267307
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102267307
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102267307
   05161 Hepatitis B
    102267307
   05160 Hepatitis C
    102267307
   05171 Coronavirus disease - COVID-19
    102267307
   05164 Influenza A
    102267307
   05162 Measles
    102267307
   05168 Herpes simplex virus 1 infection
    102267307
   05163 Human cytomegalovirus infection
    102267307
   05167 Kaposi sarcoma-associated herpesvirus infection
    102267307
   05169 Epstein-Barr virus infection
    102267307
   05165 Human papillomavirus infection
    102267307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102267307
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102267307
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102267307
NCBI-ProteinID: XP_005898516
UniProt: L8IFZ4
LinkDB
Position
Un
AA seq 195 aa
MAPAWSFLLALLLLSCNAICSLGCHQPHSHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSATTWDQSLLDKLHAALDQQLTDLQ
ACLRQEEGLPGVKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQE
RFRRKDGHTPGSTQK
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggcactgctgctgctcagctgcaacgccatctgc
tctctgggctgccaccagcctcactcccacagcctggccaacaggagggtcctgatgctc
ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccaccacgtgg
gaccagagcctcctggacaagctccacgctgcactggatcagcagctcactgacctgcaa
gcctgtctgaggcaggaggaggggctgccgggggtcaaggaggactccagcctggctgtg
aggaaatacttccacagactcactctctatctgcaagagaagagacacagcccttgtgcc
tgggaggttgtcagagcagaagtcatgagagccttctcttcctcaaccaacttgcaggag
agattcaggagaaaggacggacacacacctggttcaacacagaaatga

KEGG   Bos mutus (wild yak): 102267486
Entry
102267486         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102267486
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102267486
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102267486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102267486
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102267486
SSDB
Motif
Pfam: Interferon DUF4205 DIRP
Other DBs
NCBI-GeneID: 102267486
NCBI-ProteinID: XP_005910753
UniProt: L8HPX0
LinkDB
Position
Un
AA seq 190 aa
MAVMLSLLMALVLVSYGLGGSLGCDLSQNHMLVGRQNLRLLGQMRRLSPRFCLQDRKDFA
FPQEVVEGSQLQEAQAFSVLHEMLQQTFNLFNTEHSSAAWDTTLLEPLHTGLHQQLDDLD
ACLGQVMGEEDSVLGRTGPTLAMKRYFHGIHVYLREKEYSDCALEIMRSLSSSTSLQERL
RMMDGDLNSP
NT seq 573 nt   +upstreamnt  +downstreamnt
atggccgtcatgctctctctactgatggccctggtgcttgtcagctacggcctgggagga
tccctgggctgtgacctgtctcagaaccacatgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagactttgct
ttcccccaggaggtggtggagggtagccagctccaggaggctcaggccttctctgtgctc
cacgagatgctccagcagaccttcaaccttttcaacacagagcactcctctgctgcctgg
gacaccaccctcctggagccgctccacactggactccaccagcagctggatgacctggat
gcctgcctggggcaggtgatgggagaggaagactctgttctgggaaggacgggccccaca
ctggccatgaagaggtacttccatggaatccacgtctacctgagagagaaggaatatagt
gactgcgccttggaaatcatgagatccttgtcttcatcaaccagcttgcaagaaaggtta
agaatgatggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102267762
Entry
102267762         CDS       T02919                                 

Definition
(RefSeq) interferon alpha-F
  KO
K05414  interferon alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102267762
   04151 PI3K-Akt signaling pathway
    102267762
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102267762
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102267762
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102267762
   04621 NOD-like receptor signaling pathway
    102267762
   04622 RIG-I-like receptor signaling pathway
    102267762
   04623 Cytosolic DNA-sensing pathway
    102267762
   04650 Natural killer cell mediated cytotoxicity
    102267762
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267762
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102267762
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102267762
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102267762
   05161 Hepatitis B
    102267762
   05160 Hepatitis C
    102267762
   05171 Coronavirus disease - COVID-19
    102267762
   05164 Influenza A
    102267762
   05162 Measles
    102267762
   05168 Herpes simplex virus 1 infection
    102267762
   05163 Human cytomegalovirus infection
    102267762
   05167 Kaposi sarcoma-associated herpesvirus infection
    102267762
   05169 Epstein-Barr virus infection
    102267762
   05165 Human papillomavirus infection
    102267762
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102267762
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102267762
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102267762
NCBI-ProteinID: XP_005910754
LinkDB
Position
Un
AA seq 132 aa
MAPAWSLLLALLLLSCNAICSLGCHLPHSYRLPNRRGGSAAAWDESLLDKLRAALDQQLT
DLQACLRQEEGLRGAPLLKKDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSS
STNLQESFRRKD
NT seq 399 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttacttctggccctgctgctgctcagctgcaacgccatctgc
tctctgggctgccacctgcctcactcctaccgcctgcccaacaggagggggggctcggcc
gctgcgtgggatgagagcctcctggacaagcttcgcgctgcactggatcagcagcttact
gacctgcaagcctgtctgaggcaggaggaggggctgcgaggggcccccctgctcaagaag
gactccagcctagctgtgaggaaatacttccacagactcactctctatctgcaagagaag
agacacagcccttgtgcctgggaagtggtcagagcagaagtcatgagagccttctcttcc
tcaacaaacttgcaggagagtttcaggagaaaggactga

KEGG   Bos mutus (wild yak): 102269055
Entry
102269055         CDS       T02919                                 

Gene name
IL9
Definition
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom05310  Asthma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102269055 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102269055 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102269055 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102269055 (IL9)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102269055 (IL9)
SSDB
Other DBs
NCBI-GeneID: 102269055
NCBI-ProteinID: XP_005890485
LinkDB
Position
Un
AA seq 141 aa
MLLAVVLASALFLCSSASQGCFTLTGIRNAVYLIDNLQKDTSSKCSCSTNATDCLCLPIS
SGDCSTACFQEGLSQMSSSTVNTRFHLIVNQLKKIVVTLKSNKCGSFACEQPCNRTTTGN
TLTFLKALLESFQNDRMRGKA
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctcctggctgtggtccttgcctctgccctgttcctctgctcttcagccagccagggg
tgtttcaccttgacagggatcaggaatgctgtgtacctcatcgacaacctgcagaaagac
acgtcttcaaaatgcagctgcagcaccaatgcgactgattgtttgtgtctgcccatttcc
tctggcgactgctccacagcatgcttccaagagggtttgtcacagatgagcagctccaca
gtgaacacaagattccacctgattgtcaaccagctgaagaaaatagtcgtaaccctcaag
agcaacaagtgtggatcttttgcctgtgaacagccatgcaaccgaaccacaacaggcaat
acgctgacatttctgaaggctctgctggaaagtttccagaatgacagaatgagaggcaaa
gcatga

KEGG   Bos mutus (wild yak): 102270408
Entry
102270408         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102270408
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102270408
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102270408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102270408
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102270408
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102270408
NCBI-ProteinID: XP_014335471
LinkDB
Position
Un
AA seq 217 aa
MALLESMASENLPQGSTRRLPSQPSSSLIFPMACVLSLLMALVLVSYGPGGSLGCDLSQN
HVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEGGQLHEAQAISVLHEMLQQTFN
LFHTERSSAAWDTTLLEQLRTGLHQQLDDLDACLGTVTGEEDSALGRTGPTLAVKRYFQG
IHVYLKEKEYSDCAWEIVIMEIMRSLSSSTNLQERLR
NT seq 654 nt   +upstreamnt  +downstreamnt
atggccttgctagaaagcatggcatcagagaacctacctcaaggttccaccagacgcctt
cccagccagcccagcagcagcctcatcttccccatggcctgtgtgctctctctactgatg
gccctggtgctggtcagctacggcccgggaggatccctgggctgtgacctgtctcagaac
cacgtgctggttggcaggcagaacctcaggctcctgggccaaatgaggagactctcccct
cgcttctgtctgcaggacagaaaagacttcgctttcccccaggagatggtggagggcggc
cagctccacgaggcccaggccatctctgtgctccacgagatgctccagcagaccttcaac
ctcttccacacagagcgctcctctgctgcctgggacaccaccctcctggagcagctccgc
actggactccatcagcagctggatgacctggacgcctgcctgggcacagtgacgggagag
gaagactctgccctgggaaggacgggccccacactggccgtgaagaggtatttccagggc
atccatgtctacctgaaagagaaggaatacagcgactgcgcctgggaaatcgtcataatg
gaaatcatgagatccttgtcttcatcaaccaacttgcaagaaaggttaagatga

KEGG   Bos mutus (wild yak): 102270457
Entry
102270457         CDS       T02919                                 

Gene name
IL10
Definition
(RefSeq) interleukin 10
  KO
K05443  interleukin 10
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04068  FoxO signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04660  T cell receptor signaling pathway
bom04672  Intestinal immune network for IgA production
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05143  African trypanosomiasis
bom05144  Malaria
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05150  Staphylococcus aureus infection
bom05152  Tuberculosis
bom05310  Asthma
bom05320  Autoimmune thyroid disease
bom05321  Inflammatory bowel disease
bom05322  Systemic lupus erythematosus
bom05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102270457 (IL10)
   04068 FoxO signaling pathway
    102270457 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102270457 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102270457 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102270457 (IL10)
   04660 T cell receptor signaling pathway
    102270457 (IL10)
   04672 Intestinal immune network for IgA production
    102270457 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102270457 (IL10)
   05322 Systemic lupus erythematosus
    102270457 (IL10)
   05320 Autoimmune thyroid disease
    102270457 (IL10)
   05321 Inflammatory bowel disease
    102270457 (IL10)
   05330 Allograft rejection
    102270457 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102270457 (IL10)
   05133 Pertussis
    102270457 (IL10)
   05150 Staphylococcus aureus infection
    102270457 (IL10)
   05152 Tuberculosis
    102270457 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102270457 (IL10)
   05144 Malaria
    102270457 (IL10)
   05145 Toxoplasmosis
    102270457 (IL10)
   05140 Leishmaniasis
    102270457 (IL10)
   05142 Chagas disease
    102270457 (IL10)
   05143 African trypanosomiasis
    102270457 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102270457 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102270457 (IL10)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102270457 (IL10)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102270457 (IL10)
SSDB
Motif
Pfam: IL10 IL22 CLZ
Other DBs
NCBI-GeneID: 102270457
NCBI-ProteinID: XP_005891712
UniProt: L8IV62
LinkDB
Position
Un
AA seq 179 aa
MPSSSALLCCLVFLAGVAASRDASTLSDSSCIHFPTSLPHMLRELRAAFGRVKTFFQMKD
QLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPKAENHGPDIKEHVNSLGEKLKTL
RLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYVTTKMQK
NT seq 540 nt   +upstreamnt  +downstreamnt
atgcccagcagctcagccctgctctgttgcctggtcttcctggctggggtggcagccagc
cgagatgcgagcaccctgtctgacagcagctgtatccacttcccaaccagcctgccccac
atgctgcgggagctccgagctgccttcggcagggtgaagactttctttcaaatgaaggac
caactgcacagcttactgttgacccagtctctgctggatgactttaagggttacctgggt
tgccaagccttgtcggaaatgatccagttttacctggaagaggtgatgccaaaggctgag
aaccacgggcctgacatcaaggagcacgtgaactcgctgggggagaagctgaagaccctc
cggctccggctgcggcgctgtcatcgctttctgccctgcgaaaacaagagcaaggcggtg
gagaaggtgaagagagtcttcagtgagctccaagagaggggtgtctacaaagccatgagt
gagtttgacatcttcatcaactacatagaaacctacgtgacaacgaagatgcaaaagtga

KEGG   Bos mutus (wild yak): 102270705
Entry
102270705         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102270705
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102270705
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102270705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102270705
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102270705
SSDB
Motif
Pfam: Interferon CDT1_C DALR_2 DIRP
Other DBs
NCBI-GeneID: 102270705
NCBI-ProteinID: XP_005901404
UniProt: L8I861
LinkDB
Position
Un
AA seq 193 aa
MAFVLSLLMALALVSYGPGRSLGCDLSQNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGLLTGTSSRGRMGPTLAVKRYFQGIHVYLKEKEYSDCAWEIIIMEIMRSFSSSTSLQ
ERLRMMDGDLNSP
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcctttgtgctctctctactgatggccctggcgctggtcagctatggcccgggaaga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggaaggtggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctgcagcagaccttcaacctcttccacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggacgacctggat
gcctgcctgggcctgttgacgggaacctcttcccggggaaggatgggccccacactggct
gtgaagaggtacttccagggcatccatgtctacctgaaagagaaggaatacagcgactgt
gcctgggaaatcatcataatggaaatcatgagatccttctcttcatcgaccagcttgcaa
gaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102270981
Entry
102270981         CDS       T02919                                 

Definition
(RefSeq) interferon alpha-H
  KO
K05414  interferon alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102270981
   04151 PI3K-Akt signaling pathway
    102270981
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102270981
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102270981
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102270981
   04621 NOD-like receptor signaling pathway
    102270981
   04622 RIG-I-like receptor signaling pathway
    102270981
   04623 Cytosolic DNA-sensing pathway
    102270981
   04650 Natural killer cell mediated cytotoxicity
    102270981
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102270981
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102270981
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102270981
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102270981
   05161 Hepatitis B
    102270981
   05160 Hepatitis C
    102270981
   05171 Coronavirus disease - COVID-19
    102270981
   05164 Influenza A
    102270981
   05162 Measles
    102270981
   05168 Herpes simplex virus 1 infection
    102270981
   05163 Human cytomegalovirus infection
    102270981
   05167 Kaposi sarcoma-associated herpesvirus infection
    102270981
   05169 Epstein-Barr virus infection
    102270981
   05165 Human papillomavirus infection
    102270981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102270981
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102270981
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102270981
NCBI-ProteinID: XP_005901405
UniProt: L8IAY6
LinkDB
Position
Un
AA seq 189 aa
MAPAWSFLLALLLLSCNAICSLGCHLPHTHSPPNRRVLTLLRQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSAEGSAAVWDESLLDKLRTALDQQLTDLQ
FCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLREKRHSPCAWEVVRAEVMRAFSSSTN
LQERFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc
tctttgggttgccacctgcctcacacccacagcccgcccaacaggagggtcctgacactc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgca
ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcgcagagggctcagccgccgtgtgg
gatgagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa
ttctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatctgcgagagaagagacacagc
ccttgtgcctgggaagttgtcagagcagaagtcatgagagccttctcttcttcaacaaac
ttgcaggagagattcaggagaaaggactga

KEGG   Bos mutus (wild yak): 102271031
Entry
102271031         CDS       T02919                                 

Gene name
IFNL1
Definition
(RefSeq) interferon lambda 1
  KO
K05447  interferon lambda 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271031 (IFNL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102271031 (IFNL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102271031 (IFNL1)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102271031 (IFNL1)
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 102271031
NCBI-ProteinID: XP_014332095
LinkDB
Position
Un
AA seq 169 aa
MAATWTLVLVVMGLGLARARAVPTTTRKGCNTGMFKSLLPGELVAFKKEKDRNSLEDSLL
QKDWDCISHLFPRTRDLKHLQSPSMCPLYSLPCVGVPHTLGARLVLTLKGPGGRDYLIPG
PHPGAAPSDDTPTTASSRPPTAGCRPQGLFQHWLPQLQEAPEKSDPGKG
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctgcaacatggacgctggttctggtggtcatggggctgggcttggccagagcacgt
gctgtccccaccacaaccagaaaaggctgtaacactggcatgttcaaatctctgctgcca
ggtgagctggtggccttcaagaaagaaaaggatcggaattccttagaagactcgctcttg
cagaaggactgggactgcatctcccacctgttccccaggacccgggatctgaagcacctc
cagtctccttccatgtgtcccctctactcactcccgtgtgtgggagtgccccatacctta
ggggcaaggctggtcctgaccctgaagggtcctgggggccgtgattacctcatccctgga
ccacaccctggggcagccccttctgacgacactccaaccactgcgagctccaggcctccc
acagcaggctgcaggccccagggcctcttccagcactggctgccacagctccaggaggcc
ccagagaagagtgaccctggaaaaggatga

KEGG   Bos mutus (wild yak): 102271576
Entry
102271576         CDS       T02919                                 

Gene name
LIF
Definition
(RefSeq) leukemia inhibitory factor
  KO
K05419  leukemia inhibitory factor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271576 (LIF)
   04668 TNF signaling pathway
    102271576 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102271576 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102271576 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102271576 (LIF)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102271576 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 102271576
NCBI-ProteinID: XP_005887571
LinkDB
Position
Un
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCATRHPCPSNLMNQIRNQLGQLNSSAN
SLFILYYTAQGEPFPNNLDKLCSPNVTDFPPFHANGTEKARLVELYRIIAYLGASLGNIT
RDQKVLNPYAHGLHSKLSTTADVLRGLLSNVLCRLCSKYHVSHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQVIAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccttgctgctggttctccactggaaacacggg
gccgggagcccccttcccatcaccccggtcaacgccacctgtgccacccgccatccctgt
cccagcaacctcatgaaccagatcagaaaccagctgggacaactcaacagcagtgccaac
agcctctttatcctctattacacggcccagggggagcccttccccaacaacctggacaag
ctgtgcagccccaacgtgactgacttcccgcccttccacgccaacggcacggagaaggcc
cggctggtggagctgtaccgcatcatcgcgtacctgggcgcctccctgggcaacatcacg
agagaccagaaggtcctcaacccctacgcccacggcctgcacagcaagctgagcaccacg
gccgacgtcctgcggggtctgctcagcaacgtgctctgccgcttgtgcagcaagtaccac
gtgagccacgtggacgtgacctacggccccgacacctcgggcaaggacgtcttccagaag
aagaagctgggctgtcagctcctggggaagtacaagcaggtcatcgccgtgttggcccag
gccttctag

KEGG   Bos mutus (wild yak): 102271825
Entry
102271825         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271825
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102271825
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102271825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102271825
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102271825
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102271825
NCBI-ProteinID: XP_005901407
UniProt: L8I9Y6
LinkDB
Position
Un
AA seq 195 aa
MAFMLSLLTALVLVSYGSGRSLGCDLSQNHVLVGRKNLRLLGQMRRLSPRFCLQDRKDFT
FPQEMVEGGQLQGAQGFSVLHEMLQQTFNLFNTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGPVTGEEDSALGRMGPTLAVKRYFQGIHVYLKEKEYSDCAWEIVIVEIMRSFSSSTS
LQERLRMKDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcatgctgtctctactgacggccctggtgctggtcagctatggctcgggaaga
tccctgggctgtgacctgtctcagaaccacgtgctggttggaagaaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagactttact
ttcccccaggagatggtggagggcggccagctccagggggcccagggcttctctgtgctc
cacgagatgctccagcagaccttcaaccttttcaacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggatgacctggac
gcctgcttgggcccagtgacgggagaggaagactctgccctgggaaggatgggccccaca
ctggccgtgaagaggtacttccagggcatccatgtctacctgaaagagaaggaatacagc
gactgcgcctgggaaatcgtcatagtggaaatcatgagatccttctcttcatcgaccagc
ttgcaagaaaggttaagaatgaaggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102271854
Entry
102271854         CDS       T02919                                 

Gene name
OSM
Definition
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102271854 (OSM)
   04151 PI3K-Akt signaling pathway
    102271854 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102271854 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102271854 (OSM)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102271854 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 102271854
NCBI-ProteinID: XP_005887572
LinkDB
Position
Un
AA seq 237 aa
MRAQRMQRTLLSLVLRLLLLCTVATGKCSGKYHELLLQLQRQADLMQDPSTLLDPYIRLQ
GLHSPVLQEHCRERPGDFPSEDALWRLSRQDFLQTLNTTLGLILRMLSALQQDLPEAAHQ
QAEMNVRGFGNNIHCMAQLLSGSSDPKAAEPTQPGPGPTPLPPTPPSSTFQRKLRNCGFL
RGYHRFMRTAGQVLRGWGERQGRSRRHSPCRALKRGARRTRPFPEVRRLAPRGQPPR
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcgggcacaacgtatgcagagaacactgctcagtctggtcctcagacttctgctcctg
tgcacagtggccacgggcaagtgctcgggcaagtaccacgagcttctcctgcagctccag
cgccaggcggacctcatgcaggaccccagcacgctcctggatccctatatccgcctccaa
ggcctgcacagtcccgtactgcaggaacactgcagggagcgcccgggggactttcccagc
gaggatgccctgtggaggctcagcaggcaggacttcctgcagaccctcaacaccacgctg
ggcctcatccttcgcatgctgagtgccctgcagcaggacctcccggaagcagcccaccaa
caggcggagatgaatgtccgcgggttcgggaacaacatccactgcatggcccagctgctg
agtggctcctcggacccaaaggctgctgagcccacccagccgggcccagggcccacgccg
ctgccacccacgccgccttccagcaccttccagcgcaagctcaggaactgtgggttcctg
cgaggctaccaccgcttcatgcgcacagccgggcaggtcctccggggctggggggagaga
cagggccgcagccgcagacacagcccctgccgggccctgaagaggggggcccgcaggaca
cggcccttcccggaggtcaggagactcgcgcccaggggccagccgccccggtag

KEGG   Bos mutus (wild yak): 102272045
Entry
102272045         CDS       T02919                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04672  Intestinal immune network for IgA production
bom05140  Leishmaniasis
bom05200  Pathways in cancer
bom05310  Asthma
bom05320  Autoimmune thyroid disease
bom05321  Inflammatory bowel disease
bom05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272045 (IL4)
   04151 PI3K-Akt signaling pathway
    102272045 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272045 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102272045 (IL4)
   04660 T cell receptor signaling pathway
    102272045 (IL4)
   04658 Th1 and Th2 cell differentiation
    102272045 (IL4)
   04659 Th17 cell differentiation
    102272045 (IL4)
   04657 IL-17 signaling pathway
    102272045 (IL4)
   04664 Fc epsilon RI signaling pathway
    102272045 (IL4)
   04672 Intestinal immune network for IgA production
    102272045 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272045 (IL4)
  09163 Immune disease
   05310 Asthma
    102272045 (IL4)
   05320 Autoimmune thyroid disease
    102272045 (IL4)
   05321 Inflammatory bowel disease
    102272045 (IL4)
   05330 Allograft rejection
    102272045 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102272045 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272045 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102272045 (IL4)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102272045 (IL4)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102272045 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102272045
NCBI-ProteinID: XP_005888424
UniProt: L8J2E0
LinkDB
Position
Un
AA seq 135 aa
MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP
KNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL
LERLKTIMKEKYSKC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgatcccagtgctggtctgcttactggtatgtaccagtcac
ttcgtccatggacacaagtgtgatattaccttagcagagatcatcaaaacgctgaacatc
ctcacaacgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca
aagaacacaactgagaaggaaaccttctgcagggttggaattgagcttaggcgtatttac
aggagccacacgtgcttgaacaaattcctgggcggacttgacaggaatctcaacagcttg
gcaagcaagacctgttctgtgaatgaagccaagacgagcacaagtacgctgaaagacctc
ttggaaaggctaaagacgattatgaaggagaaatactccaagtgttga

KEGG   Bos mutus (wild yak): 102272108
Entry
102272108         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272108
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272108
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102272108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272108
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102272108
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 102272108
NCBI-ProteinID: XP_005901408
UniProt: L8I7C2
LinkDB
Position
Un
AA seq 193 aa
MAVMLSLLMALVLVSYGLGGSLGCDLSQNHMLVGRQNLRLLGQMRRLSPRFCLQDRKDFA
FPQEVVEGSQLQEAQAFSVLHEMLQQTFNLFNTEHSSAAWDTPLLEPLHTGLHQQLDDLD
ACLGQVMGEEDSVLGRTGPTLAMKRYFHGIHVYLREKEYSDCAWEIVRLEIMRSLSSSTN
LQERLRMMDGDQN
NT seq 582 nt   +upstreamnt  +downstreamnt
atggccgtcatgctctctctactgatggccctggtgcttgtcagctacggcctgggagga
tccctgggctgtgacctgtctcagaaccacatgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagactttgct
ttcccccaggaggtggtggagggtagccagctccaggaggctcaggccttctctgtgctc
cacgagatgctccagcagaccttcaaccttttcaacacagagcactcctctgctgcctgg
gacacccccctcctggagccgctccacactggactccatcagcagctggatgacctggat
gcctgcctggggcaggtgatgggagaggaagactctgttctgggaaggacgggccccaca
ctggccatgaagaggtacttccatggaatccacgtctacctgagagagaaggaatatagt
gactgcgcctgggaaatcgtcagactggaaatcatgagatctttgtcttcatcaaccaac
ttgcaagaaaggttaagaatgatggatggagaccagaattaa

KEGG   Bos mutus (wild yak): 102272332
Entry
102272332         CDS       T02919                                 

Gene name
IL13
Definition
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04664  Fc epsilon RI signaling pathway
bom05200  Pathways in cancer
bom05310  Asthma
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272332 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272332 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102272332 (IL13)
   04657 IL-17 signaling pathway
    102272332 (IL13)
   04664 Fc epsilon RI signaling pathway
    102272332 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272332 (IL13)
  09163 Immune disease
   05310 Asthma
    102272332 (IL13)
   05321 Inflammatory bowel disease
    102272332 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272332 (IL13)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102272332 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 102272332
NCBI-ProteinID: XP_005888425
UniProt: L8IYT3
LinkDB
Position
Un
AA seq 146 aa
MRLLLNSSCAVLGSMALLLTAVIVLICFGGLTSPSPVPSATALKELIEELVNITQNQKVP
LCNGSMVWSLNLTSSMYCAALDSLISISNCSVIQRTKRMLNALCPHKPSAKQVSSEYVRD
TKIEVAQFLKDLLRHSRIVFRNGRFN
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcgtctgctcctcaattcttcctgtgctgttctaggctccatggcgctcttattgacc
gcggtcattgttcttatctgctttggtggcctcacctccccaagccctgtgccttctgct
acagccctcaaggagctcattgaagagctggttaatatcacccagaaccagaaggtgccg
ctgtgcaatggcagcatggtgtggagcctcaacctgacgagcagcatgtactgtgcagcc
ctggactccctgatcagcatctccaactgcagtgtcatccaaaggaccaagaggatgctg
aatgcactctgtcctcacaagccctcagctaagcaggtttccagtgagtacgtccgagac
accaaaattgaagtggcccagttcttaaaagacctgctcagacattcaaggatcgttttt
cgcaatggaagattcaactga

KEGG   Bos mutus (wild yak): 102272426
Entry
102272426         CDS       T02919                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04151  PI3K-Akt signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04672  Intestinal immune network for IgA production
bom04940  Type I diabetes mellitus
bom05135  Yersinia infection
bom05142  Chagas disease
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
bom05321  Inflammatory bowel disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272426 (IL2)
   04151 PI3K-Akt signaling pathway
    102272426 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272426 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102272426 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102272426 (IL2)
   04660 T cell receptor signaling pathway
    102272426 (IL2)
   04658 Th1 and Th2 cell differentiation
    102272426 (IL2)
   04659 Th17 cell differentiation
    102272426 (IL2)
   04672 Intestinal immune network for IgA production
    102272426 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272426 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102272426 (IL2)
   05321 Inflammatory bowel disease
    102272426 (IL2)
   05330 Allograft rejection
    102272426 (IL2)
   05332 Graft-versus-host disease
    102272426 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102272426 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102272426 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272426 (IL2)
   05171 Coronavirus disease - COVID-19
    102272426 (IL2)
   05162 Measles
    102272426 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102272426 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272426 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102272426 (IL2)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102272426 (IL2)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102272426 (IL2)
SSDB
Motif
Pfam: IL2 DUF922
Other DBs
NCBI-GeneID: 102272426
NCBI-ProteinID: XP_005908401
UniProt: L8HS84
LinkDB
Position
Un
AA seq 155 aa
MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH
TFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG
SETRFTCEYDDATVNAVEFLNKWITFCQSIYSTMT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt
gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat
ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat
acatttgacttttacgtgcccaaggttaacgctacagaattgaaacatcttaagtgttta
ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac
cccagagagatcaaggattcaatggacaatatcaagagaatcgttttggaactacaggga
tctgaaacaagattcacatgtgaatatgatgatgcaacagtaaacgctgtagaatttctg
aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

KEGG   Bos mutus (wild yak): 102272591
Entry
102272591         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272591
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272591
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102272591
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272591
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102272591
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102272591
NCBI-ProteinID: XP_014335470
LinkDB
Position
Un
AA seq 186 aa
MAVMLSLLMALVLVSYGPGGSLGCDLSQNHALVGRKNLRLLGQMSRLSPRFCLQDRKDFA
FPQEIVEGGQLQEAQAISVLHEMLQQTFDLFHTERFSAAWDTTLLEQLRIGLHQQLDDLD
ACLGQGMGEQNSALGRMGPTLAMKRYFQSIHVYLQEKEYSDCAWEIVRVEMMRSFSSSAS
LQERLR
NT seq 561 nt   +upstreamnt  +downstreamnt
atggccgttatgctctctctactgatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacctgtctcagaaccacgcgctggttggcaggaagaacctcaggctc
ctgggccaaatgagcaggctctctcctcgcttctgtctacaggacagaaaagactttgct
ttcccccaggagatagtggagggcggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagaccttcgacctcttccacacagagcgcttctctgctgcctgg
gacaccaccctcctagagcagctccgcattggactccatcagcagctggatgacctggac
gcctgcctggggcaggggatgggagagcaaaactctgccctgggaaggatgggccccaca
ctggccatgaagaggtatttccagagcatccatgtctacctgcaagagaaggaatacagc
gactgcgcctgggaaatcgtcagagtggagatgatgagatccttctcttcatcagccagc
ttgcaagaaaggttaagatga

KEGG   Bos mutus (wild yak): 102272910
Entry
102272910         CDS       T02919                                 

Gene name
IL5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04672  Intestinal immune network for IgA production
bom05200  Pathways in cancer
bom05310  Asthma
bom05320  Autoimmune thyroid disease
bom05321  Inflammatory bowel disease
bom05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102272910 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102272910 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102272910 (IL5)
   04660 T cell receptor signaling pathway
    102272910 (IL5)
   04658 Th1 and Th2 cell differentiation
    102272910 (IL5)
   04657 IL-17 signaling pathway
    102272910 (IL5)
   04664 Fc epsilon RI signaling pathway
    102272910 (IL5)
   04672 Intestinal immune network for IgA production
    102272910 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272910 (IL5)
  09163 Immune disease
   05310 Asthma
    102272910 (IL5)
   05320 Autoimmune thyroid disease
    102272910 (IL5)
   05321 Inflammatory bowel disease
    102272910 (IL5)
   05330 Allograft rejection
    102272910 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102272910 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102272910 (IL5)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102272910 (IL5)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102272910 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 102272910
NCBI-ProteinID: XP_005888427
UniProt: L8J309
LinkDB
Position
Un
AA seq 134 aa
MRMHLHLTLVALGAAYVCANAVESTMNRLVAETLTLLSSHRILLIGDGNLMIPTPQHTNH
QLCIEEVFQGIDTLKNQTAQGDAVKKIFQNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQ
VFLGVINTEWTMES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcatctgcatttgactttagtagctcttggagctgcttatgtttgtgccaat
gctgtagaaagtaccatgaatagactggtggcagagaccttgacactgctctcctctcat
cgaattctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcac
caactgtgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa
ggggatgctgtgaaaaaaatattccaaaacttgtctttaataaaagaatacatagacctc
caaaaaaggaagtgtggaggagaaagatggagagtgaaacaattcctagactacctgcaa
gtttttcttggtgtgattaacacagagtggacaatggaaagttga

KEGG   Bos mutus (wild yak): 102273503
Entry
102273503         CDS       T02919                                 

Gene name
IL24
Definition
(RefSeq) interleukin 24
  KO
K22668  interleukin 24
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102273503 (IL24)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102273503 (IL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102273503 (IL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102273503 (IL24)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102273503 (IL24)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 102273503
NCBI-ProteinID: XP_005891722
LinkDB
Position
Un
AA seq 228 aa
MRAGPRPAPLARELAGTGETDLLASRPAEGWKTKRPQDPPGPSLLQMNSSMHVAALPCLS
LMLLLWSPGPWVRGQEFQFGPCRVEGVVLQKLWQAFWAMKDIVQAQDNITSVRLLRKEVL
QSVSETESCHLIHALLRFYVNTVFKNYHDKAVEFGILKPFSTLANNFFVLVSKLQASQEK
MFSTRKSARRRFLLFYQAFKQLDREAAVTKAFGEMDILLSWMEKFYQL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcgtgctggccccaggcctgctcctctggctcgcgagttggcaggcactggggagaca
gacctcctggcttcccgcccagctgaggggtggaagaccaagcgtcctcaggatcctcct
ggaccttctttgctgcagatgaactcttctatgcacgtggctgctcttccctgcttgagt
ctgatgctgcttctctggagcccagggccttgggtccggggccaagagttccagtttggg
ccctgccgggtagaaggagtagttctccagaaactgtggcaggccttctgggccatgaag
gacattgtgcaagctcaagataacatcacgagtgtccggctgctgcggaaagaggttctg
cagagcgtctcggagactgagagctgccacctcatccatgccctgctgaggttctacgtg
aacactgtcttcaaaaactaccatgacaaggctgttgaattcgggatcctgaagccattc
tctactctggccaacaacttctttgtcctcgtgtcaaaactgcaagccagtcaggaaaag
atgttttccacccgtaagagtgcacgcaggcgatttttgctgttctaccaagcatttaaa
cagttggacagagaagcagctgtgaccaaagcctttggagaaatggacattctcttgagc
tggatggagaaattctaccagctctga

KEGG   Bos mutus (wild yak): 102274073
Entry
102274073         CDS       T02919                                 

Gene name
IL20
Definition
(RefSeq) interleukin 20
  KO
K22667  interleukin 20
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274073 (IL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102274073 (IL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102274073 (IL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102274073 (IL20)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102274073 (IL20)
SSDB
Motif
Pfam: IL10 IL22 DUF3587 MitMem_reg DUF4119
Other DBs
NCBI-GeneID: 102274073
NCBI-ProteinID: XP_005891723
UniProt: L8IVZ1
LinkDB
Position
Un
AA seq 176 aa
MRGSGLPLCLLSAVFYLFWTPSAGLKTLHLGSCVITTNLQGIRSGFSEIRDSVQAKDEII
DVRILRKTQSLQGTKPADQCCLLHHILRLYLDRVFKNYQPPDHHIFRKVSRLANSLLTIK
KDLRLCHAHMSCPCGEEAKEKYSQILSHFEELPPQAVVVKALGELDILLQWMEEAD
NT seq 531 nt   +upstreamnt  +downstreamnt
atgagaggttctggtcttcccctctgccttctttctgctgtgttttatctcttctggaca
ccttctgctgggctgaaaacactgcatttgggaagctgtgtgatcaccacaaatcttcag
ggaattcgaagtggattttcagagattcgggacagtgtgcaagccaaagatgaaatcatt
gacgtcagaatcttgaggaagactcagtctttgcaaggcacaaagcctgcagatcagtgc
tgcctcctccatcatatactgagactttacctggacagggtattcaaaaactatcaaccc
cctgaccaccatatcttccggaaggtcagccgtcttgccaactctcttctcaccatcaag
aaggaccttcggctgtgtcatgcccatatgtcatgcccttgtggggaagaagcaaaggag
aaatacagccagattctgagtcacttcgaagagcttccgcctcaggcagtggtggtgaag
gctttgggggagctagacattctcttgcaatggatggaagaggcagactag

KEGG   Bos mutus (wild yak): 102274357
Entry
102274357         CDS       T02919                                 

Gene name
IL19
Definition
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102274357 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102274357 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102274357 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102274357 (IL19)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102274357 (IL19)
SSDB
Motif
Pfam: IL10 DUF1664
Other DBs
NCBI-GeneID: 102274357
NCBI-ProteinID: XP_005891724
LinkDB
Position
Un
AA seq 180 aa
MKAPCVSLCLLGAGLFLCSVHARGLRRCLISMNLHRVEESFRGIKTAIQAKDTFQNVTIL
SPSETLHGIKPLDVCCVTKNLLAFYVDRVFKDHQELNPQIMRKISSLANSFLYMQKTLQQ
CQNLCHCRQEATNATRIIHDNYDQLEVRSAAVKSLGELDVFLAWIDKHHRGTSAASRQGT
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaaggcaccgtgcgtttccctctgcctcctgggtgccgggctcttcctgtgctcagtg
catgcccgaggcctcaggagatgcctgatttccatgaacttgcaccgtgtggaggagagc
ttccgaggaatcaaaacagccattcaagctaaggacaccttccaaaacgtcaccatcctg
tccccatcggagaccctgcatggcattaagcccttagatgtgtgctgcgtgaccaagaac
ctcctggcattttatgtggacagagtgttcaaggaccatcaggagctgaacccccaaatc
atgagaaaaatcagcagccttgccaactctttcctctacatgcagaagactctacaacaa
tgtcagaatctgtgtcactgcagacaggaagcaaccaatgcaaccagaatcatccatgac
aactatgatcagctggaggtccggtctgctgccgttaagtctctgggagagctggacgtc
tttctagcctggattgacaagcatcatcgaggaacttccgctgcctcaagacaaggaacc
taa

KEGG   Bos mutus (wild yak): 102275474
Entry
102275474         CDS       T02919                                 

Gene name
CSF2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04650  Natural killer cell mediated cytotoxicity
bom04657  IL-17 signaling pathway
bom04660  T cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04668  TNF signaling pathway
bom05146  Amoebiasis
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05171  Coronavirus disease - COVID-19
bom05202  Transcriptional misregulation in cancer
bom05221  Acute myeloid leukemia
bom05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275474 (CSF2)
   04668 TNF signaling pathway
    102275474 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275474 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102275474 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    102275474 (CSF2)
   04660 T cell receptor signaling pathway
    102275474 (CSF2)
   04657 IL-17 signaling pathway
    102275474 (CSF2)
   04664 Fc epsilon RI signaling pathway
    102275474 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102275474 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102275474 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102275474 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275474 (CSF2)
   05171 Coronavirus disease - COVID-19
    102275474 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275474 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102275474 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bom03019]
    102275474 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102275474 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102275474 (CSF2)
Messenger RNA biogenesis [BR:bom03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     102275474 (CSF2)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   102275474 (CSF2)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102275474 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 102275474
NCBI-ProteinID: XP_005888437
UniProt: L8IZE0
LinkDB
Position
Un
AA seq 143 aa
MWLQNLLLLGTVVCSFSAPTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVS
EKFDSQEPTCLQTRLKLYKKGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFK
NFKEDLKEFLFIIPFDCWEPAQK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttctcctgggcactgtggtctgcagcttctccgcacctact
cgcccacccaacactgccacccggccctggcagcatgtggatgccatcaaggaggccctg
agccttctgaaccacagcagtgacactgatgctgtgatgaatgacacagaagtcgtctct
gaaaagtttgactcccaggagccaacgtgcctgcagactcgcctgaagctgtacaagaag
ggcctgcagggcagcctcactagtctcatgggctccttgaccatgatggccacccactac
gagaaacactgcccacccaccccggaaacttcctgtggaacccagtttatcagcttcaaa
aatttcaaagaggacctgaaggagttcctttttatcattccctttgactgctgggaacca
gcccagaagtga

KEGG   Bos mutus (wild yak): 102275760
Entry
102275760         CDS       T02919                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04664  Fc epsilon RI signaling pathway
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05221  Acute myeloid leukemia
bom05310  Asthma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102275760 (IL3)
   04151 PI3K-Akt signaling pathway
    102275760 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102275760 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102275760 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102275760 (IL3)
   04664 Fc epsilon RI signaling pathway
    102275760 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275760 (IL3)
   05202 Transcriptional misregulation in cancer
    102275760 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102275760 (IL3)
  09163 Immune disease
   05310 Asthma
    102275760 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102275760 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102275760 (IL3)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102275760 (IL3)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102275760 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102275760
NCBI-ProteinID: XP_005888438
UniProt: L8J314
LinkDB
Position
Un
AA seq 144 aa
MSSLSILHLLLLLLALHAPQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEK
NFLTKESLLQANLKVFMTFATDTFGNDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGD
FRMKLEEYLVIIRNYLKSKNIWFS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagtctctccatcttgcacctgcttctgctcctgcttgcactccatgcccctcag
gcaaaggggttgcctgtcgtgacatcgaggactccatattctatgttgatgaaggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatttcctgacgaaagagagccttctgcaggcaaacctgaaagtattcatgacatttgcc
acagatacttttggaaacgattcaaaaatcatgaaaaatcttaaggaattccagcctgtg
ctgcccacagccacacccacggaagatccaatttttattgagaacaagaacttgggcgat
ttccggatgaaattggaagaatatttggttatcattagaaactatctgaagtccaagaac
atatggttttcctaa

KEGG   Bos mutus (wild yak): 102276398
Entry
102276398         CDS       T02919                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04620  Toll-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04940  Type I diabetes mellitus
bom05133  Pertussis
bom05134  Legionellosis
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05143  African trypanosomiasis
bom05144  Malaria
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05162  Measles
bom05164  Influenza A
bom05168  Herpes simplex virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
bom05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102276398 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102276398 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102276398 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    102276398 (IL12A)
   04625 C-type lectin receptor signaling pathway
    102276398 (IL12A)
   04658 Th1 and Th2 cell differentiation
    102276398 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102276398 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102276398 (IL12A)
   05330 Allograft rejection
    102276398 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102276398 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102276398 (IL12A)
   05134 Legionellosis
    102276398 (IL12A)
   05152 Tuberculosis
    102276398 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102276398 (IL12A)
   05164 Influenza A
    102276398 (IL12A)
   05162 Measles
    102276398 (IL12A)
   05168 Herpes simplex virus 1 infection
    102276398 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102276398 (IL12A)
   05144 Malaria
    102276398 (IL12A)
   05145 Toxoplasmosis
    102276398 (IL12A)
   05140 Leishmaniasis
    102276398 (IL12A)
   05142 Chagas disease
    102276398 (IL12A)
   05143 African trypanosomiasis
    102276398 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102276398 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102276398 (IL12A)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102276398 (IL12A)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102276398 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 102276398
NCBI-ProteinID: XP_005904469
LinkDB
Position
Un
AA seq 221 aa
MCPLRSLLLISTLVLLHHLPHLSLGRSLPPTTASPGRSCLDYSQNLLRAVSNTLQKARQT
LEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSFITNGHCLASGKTSF
MTTLCLRSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFDSETVP
QKPSLKELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtgcccgcttcgcagcctcctcctcatatccaccctggttctcctccaccacctgccc
cacctcagtttgggcaggagcctcccccccaccacagcaagcccaggaaggagctgcctc
gactactcccaaaacctgctgagggctgtcagcaacacgctacagaaggccagacaaacc
ctagaattttactcctgcacttctgaggagatcgatcatgaagatatcaccaaagataaa
accagcacagtggaggcctgtttaccactggaattagccacgaatgagagttgcctggct
tccagagagacctcttttataactaatgggcattgtctggcttctggaaagacctctttt
atgacaaccctgtgccttagaagtatctatgaggacttgaagatgtaccacgtggagttc
caggccatgaatgcaaagcttctgatggatcctaagaggcaaatctttctagaccagaac
atgctggcagctattgctgagctgatgcaggccctgaatttcgacagtgagactgtgcca
cagaaaccctccctgaaagaactggatttttacaagacaaaagtcaagctctgcatcctt
cttcacgccttcagaattcgtgcggtgaccatcgacagaatgatgagctatctgagttct
tcctag

KEGG   Bos mutus (wild yak): 102276455
Entry
102276455         CDS       T02919                                 

Gene name
IL15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04668  TNF signaling pathway
bom04672  Intestinal immune network for IgA production
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102276455 (IL15)
   04668 TNF signaling pathway
    102276455 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102276455 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102276455 (IL15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102276455 (IL15)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102276455 (IL15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102276455 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102276455 (IL15)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102276455 (IL15)
SSDB
Motif
Pfam: IL15 AKAP28
Other DBs
NCBI-GeneID: 102276455
NCBI-ProteinID: XP_005911437
LinkDB
Position
Un
AA seq 162 aa
MRILKPYLRSTSIQCYLCLLLNSHFLTEAGIHVFILGCISASLPKTEANWQYVINDLKTI
EHLIQSIHMDATLYTESDAHPNCKVTAMQCFLLELRVILHESKNATIYEIIENLTMLANS
NLSSIENKTELGCKECEELEEKSIKEFLKSFVHIVQMFINTS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagaattttgaaaccatatttgagaagtacttccatccagtgctacttgtgtttactt
ctgaacagtcattttttaacagaggctggcattcatgtcttcattttgggctgtatcagt
gcaagtcttcccaaaacagaagcaaactggcagtatgtaataaatgatttgaaaacaatt
gagcatcttattcaatctatacatatggatgccactttatatactgaaagtgatgctcat
cccaattgcaaagtaacagcgatgcagtgctttctcctggagttacgagttattttacac
gagtccaaaaatgccaccatttatgaaataatagaaaatcttaccatgctagcaaacagc
aatttatcttctattgagaataaaacagaattgggatgcaaagaatgtgaggaactggag
gaaaaaagtatcaaagaatttttgaagagttttgtacatattgtgcaaatgttcatcaac
acttcttga

KEGG   Bos mutus (wild yak): 102277364
Entry
102277364         CDS       T02919                                 

Gene name
IL17D
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04657  IL-17 signaling pathway
bom04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102277364 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102277364 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102277364 (IL17D)
   04659 Th17 cell differentiation
    102277364 (IL17D)
   04657 IL-17 signaling pathway
    102277364 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102277364 (IL17D)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102277364 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 102277364
NCBI-ProteinID: XP_014337637
LinkDB
Position
Un
AA seq 101 aa
MEEHGVVRISYDPGRFPRYLPEAYCLCRGCLTGPRGEEDVRLRSAPVLVPAVVLRRTPGC
AGGRAVYVEEYVTVPVGCTCVPGPDKDADAANSSLDKSARP
NT seq 306 nt   +upstreamnt  +downstreamnt
atggaggaacatggagtggtcaggatctcctacgacccgggccgcttcccgcggtacctg
cccgaggcctactgcctgtgccggggctgcctgaccgggccacgcggggaggaggacgtg
cgcctgcgcagcgccccagtgctcgtgcccgcggtggtcctgcgccgcaccccgggctgc
gcaggcggtcgcgccgtctacgtcgaggagtatgtcactgtgcccgtgggctgcacctgc
gtgcccgggccggacaaggatgcggacgccgccaactccagcctggacaagtcggcccgg
ccctga

KEGG   Bos mutus (wild yak): 102277434
Entry
102277434         CDS       T02919                                 

Gene name
IFNK
Definition
(RefSeq) interferon kappa
  KO
K05441  interferon kappa
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102277434 (IFNK)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102277434 (IFNK)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102277434 (IFNK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102277434 (IFNK)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102277434 (IFNK)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102277434
NCBI-ProteinID: XP_005886724
UniProt: L8J488
LinkDB
Position
Un
AA seq 215 aa
MITKPDGIRKYVWLACLMGLFITGILSLDCNSLNVRLRRVTWQNLQLLSTMSNSFPIECL
QERKAFELPQEILSYTQPLKKNIKEAFYEMSKQAFHIFTQDTFQSTWEEKHLRQVQIGLD
HQLQYLEQCLEEEEEENEDTREREELLSAGEETLRKPSGAPVLQLGNLDLRRYFNRIDRF
LKDKKHSHCAWEIVRVEIRRCFYFFQKLTALLRRR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgatcaccaagcctgatgggattcgaaagtatgtgtggctggcatgcctcatgggtctg
tttatcactggcatcctctctctggactgtaactcgctgaatgttcgcctgaggagagtc
acctggcagaatctgcaacttctgagcacaatgagcaattcatttcctatagagtgtcta
caagaaagaaaagctttcgagttgccccaagagatcctctcatacacccagcctctgaag
aagaacatcaaggaggccttctatgaaatgtccaaacaggccttccacatcttcactcaa
gacaccttccaatccacttgggaagagaaacacctgagacaagtccagatcggacttgat
caccagctgcagtacctggagcaatgcttggaagaagaggaggaggaaaatgaagacaca
agagagagggaagagcttctctcagccggagaggagaccctcaggaaaccctcaggagct
ccggtcctccagctgggcaatctagatctgaggagatatttcaacaggatagacaggttc
ctcaaagataagaaacacagtcactgcgcctgggagattgtccgagtggaaatcagaaga
tgcttctacttctttcagaaactcacagcattactcaggaggagataa

KEGG   Bos mutus (wild yak): 102277988
Entry
102277988         CDS       T02919                                 

Gene name
IL23A
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom05133  Pertussis
bom05152  Tuberculosis
bom05200  Pathways in cancer
bom05321  Inflammatory bowel disease
bom05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102277988 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102277988 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102277988 (IL23A)
   04659 Th17 cell differentiation
    102277988 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277988 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102277988 (IL23A)
   05321 Inflammatory bowel disease
    102277988 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102277988 (IL23A)
   05152 Tuberculosis
    102277988 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102277988 (IL23A)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102277988 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 102277988
NCBI-ProteinID: XP_005903496
UniProt: L8I5H4
LinkDB
Position
Un
AA seq 192 aa
MLGNRAVMLLLLLLLPWTAQGRAVSEDSSPAWTRGQQLSQQLCMLAWSAHLPMGHVDLPR
EEGGDKTTDDVPRIQCEDGCDPQGLRDNSQSCLQRIHRGLVFYEKLLGSDIFTGEPSLLP
DGPVDQLHASILGLRELLQPKGHHWETEQTPSPIPSQPWQRLLLRLKILRSLQAFVAVAA
RVFAHGAATLSP
NT seq 579 nt   +upstreamnt  +downstreamnt
atgctggggaacagagctgtgatgctgctgctgctgctactgctgccctggacagctcag
ggccgggctgtgtcagaggacagcagccctgcttggactcggggccaacagctctcacag
caactctgcatgctggcctggagtgcacacctaccaatgggacatgtggatctaccaaga
gaagaaggaggtgataagactacagatgatgtcccccgtatccagtgtgaggatggctgt
gatccacaaggactcagggacaacagtcagtcctgcttgcaaagaattcatcgaggcctg
gttttttacgagaagctgctgggctcagatattttcacaggggagccttctctactccca
gatggccctgtggaccagcttcatgcctccatactgggcctcagggaactcttgcagccc
aagggtcaccactgggaaactgagcagactccaagccctattcccagccagccatggcag
cgcctccttctccgtctcaagatccttcgaagcctccaggcctttgtggctgtagctgcc
cgggtctttgcccacggagcagcaactctgagcccctaa

KEGG   Bos mutus (wild yak): 102280497
Entry
102280497         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102280497
   04668 TNF signaling pathway
    102280497
   04151 PI3K-Akt signaling pathway
    102280497
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102280497
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102280497
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102280497
   04621 NOD-like receptor signaling pathway
    102280497
   04622 RIG-I-like receptor signaling pathway
    102280497
   04623 Cytosolic DNA-sensing pathway
    102280497
   04650 Natural killer cell mediated cytotoxicity
    102280497
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102280497
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102280497
   05152 Tuberculosis
    102280497
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102280497
   05161 Hepatitis B
    102280497
   05160 Hepatitis C
    102280497
   05171 Coronavirus disease - COVID-19
    102280497
   05164 Influenza A
    102280497
   05162 Measles
    102280497
   05168 Herpes simplex virus 1 infection
    102280497
   05163 Human cytomegalovirus infection
    102280497
   05167 Kaposi sarcoma-associated herpesvirus infection
    102280497
   05169 Epstein-Barr virus infection
    102280497
   05165 Human papillomavirus infection
    102280497
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102280497
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102280497
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102280497
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102280497
NCBI-ProteinID: XP_005898555
UniProt: L8IFW6
LinkDB
Position
Un
AA seq 182 aa
MTYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSLAVLGQLPSTPQHCLEARMDFQVPEE
MNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLVELYGQMNRLQPIQK
EIMQKQNSTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVRVQILRNFSFLTRLTGYL
RD
NT seq 549 nt   +upstreamnt  +downstreamnt
atgacctaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcgattccaacaaaggcggagccttgcggtactggggcag
ttaccttcaacgcctcaacattgcctcgaggccaggatggacttccaggtccctgaggag
atgaaccaagcacagcagttccggaaggaagatgccatattggtcatctatgagatgctc
cagcagatcttcaatattctcaccagagacttctccagcactggctggtctgagaccatc
attgaggacctccttgtggaactctatgggcagatgaatcgtctgcagccaatccagaag
gaaataatgcagaagcaaaactccactatgggagacacgactgttcttcacctgaggaaa
tattacttcaacctcgtgcagtacctgaagtccaaggagtacaacaggtgtgcctggaca
gtcgtgcgagtgcaaatactcaggaatttttctttcctgacgagactaacaggttacctc
cgtgactga

KEGG   Bos mutus (wild yak): 102281065
Entry
102281065         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281065
   04668 TNF signaling pathway
    102281065
   04151 PI3K-Akt signaling pathway
    102281065
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102281065
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102281065
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102281065
   04621 NOD-like receptor signaling pathway
    102281065
   04622 RIG-I-like receptor signaling pathway
    102281065
   04623 Cytosolic DNA-sensing pathway
    102281065
   04650 Natural killer cell mediated cytotoxicity
    102281065
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102281065
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102281065
   05152 Tuberculosis
    102281065
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102281065
   05161 Hepatitis B
    102281065
   05160 Hepatitis C
    102281065
   05171 Coronavirus disease - COVID-19
    102281065
   05164 Influenza A
    102281065
   05162 Measles
    102281065
   05168 Herpes simplex virus 1 infection
    102281065
   05163 Human cytomegalovirus infection
    102281065
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281065
   05169 Epstein-Barr virus infection
    102281065
   05165 Human papillomavirus infection
    102281065
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102281065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102281065
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102281065
SSDB
Motif
Pfam: Interferon DUF2154
Other DBs
NCBI-GeneID: 102281065
NCBI-ProteinID: XP_005898557
UniProt: L8IE01
LinkDB
Position
Un
AA seq 186 aa
MTHRCLLPVVLLLCFSTTALSRSYSLLQFQQRRSLAVCQKLLWQLPSTPQHCLEARMDFQ
MPEEMKEEQQFQKEDAILVIYEMLQHIFGILTRDFSNTGWSETIIEDLLEELYGQMNRLE
PIQKEIMQKQNFTMGDTTVLHLRKYYFNLVQYLKSKEYNRCAWTVVQVQILTNFSFLMRL
TDYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccgttgcctcctcccagtggttctcctgctgtgtttctccaccacagctctt
tccaggagctacagcttgcttcaattccaacaaaggcggagccttgcagtgtgtcagaaa
ctcctgtggcagttaccttcaactcctcaacattgcctcgaggccaggatggacttccag
atgcctgaggagatgaaggaagaacagcagttccagaaggaagatgccatattggtcatc
tatgagatgctccagcacatcttcggcattctcaccagagacttctccaacactggctgg
tctgagaccatcatcgaggacctccttgaggaactctatgggcagatgaatcgtctggag
ccaatccaaaaggaaataatgcagaagcaaaatttcactatgggagacacaaccgttctt
cacctgaggaaatattacttcaacctcgtgcagtacctgaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcaagtgcaaatactcacgaacttttctttcctgatgagacta
acagattacctccgtgactga

KEGG   Bos mutus (wild yak): 102281344
Entry
102281344         CDS       T02919                                 

Definition
(RefSeq) interferon alpha-2
  KO
K05414  interferon alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102281344
   04151 PI3K-Akt signaling pathway
    102281344
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102281344
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102281344
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102281344
   04621 NOD-like receptor signaling pathway
    102281344
   04622 RIG-I-like receptor signaling pathway
    102281344
   04623 Cytosolic DNA-sensing pathway
    102281344
   04650 Natural killer cell mediated cytotoxicity
    102281344
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102281344
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102281344
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102281344
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102281344
   05161 Hepatitis B
    102281344
   05160 Hepatitis C
    102281344
   05171 Coronavirus disease - COVID-19
    102281344
   05164 Influenza A
    102281344
   05162 Measles
    102281344
   05168 Herpes simplex virus 1 infection
    102281344
   05163 Human cytomegalovirus infection
    102281344
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281344
   05169 Epstein-Barr virus infection
    102281344
   05165 Human papillomavirus infection
    102281344
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102281344
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102281344
SSDB
Motif
Pfam: Interferon Tom37
Other DBs
NCBI-GeneID: 102281344
NCBI-ProteinID: XP_005898558
UniProt: L8IFX0
LinkDB
Position
Un
AA seq 184 aa
MALPVTVLLALVMLCSSPTCSLGCELPLSHGNLESFTRWSQMERVPIVSCLRDRTDFRFP
QTLVHGTRLEKTQATAVVQLLQQTFQLFSTMGSSAGREESLLDRFLVGLDQQLEDLDTCL
REGRTPEQSPLGSENSRLAVKSYFQRISVYLKEKEYSHCAWEVVSVEIRRCLVFASKLIG
KLRK
NT seq 555 nt   +upstreamnt  +downstreamnt
atggccctccccgtcactgtgctgctggccctggtgatgctctgctccagccccacgtgc
tccctgggctgtgagctgcctttgagccacggcaatctggaaagtttcacacgttggagt
cagatggagagagtgcccattgtgtcctgtctgagggacaggactgacttcagatttcct
cagaccctggtgcacgggaccaggcttgagaagacacaagccacagctgttgtgcagttg
ctccagcagaccttccagctcttcagcaccatgggctcttctgcaggtcgggaggagagc
ctcctggacagattcctcgtgggacttgatcagcagttggaggacctggacacgtgtctg
agggagggaaggacaccggaacagtcacctctagggagtgagaactccagattggctgtg
aagagttacttccagcgaatcagtgtgtatctcaaagagaaagaatacagccactgtgcc
tgggaggttgtcagcgtggaaatcagaaggtgcttggtctttgccagcaagctcattgga
aaactcaggaaataa

KEGG   Bos mutus (wild yak): 102282466
Entry
102282466         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102282466
   04668 TNF signaling pathway
    102282466
   04151 PI3K-Akt signaling pathway
    102282466
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102282466
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102282466
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102282466
   04621 NOD-like receptor signaling pathway
    102282466
   04622 RIG-I-like receptor signaling pathway
    102282466
   04623 Cytosolic DNA-sensing pathway
    102282466
   04650 Natural killer cell mediated cytotoxicity
    102282466
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102282466
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102282466
   05152 Tuberculosis
    102282466
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102282466
   05161 Hepatitis B
    102282466
   05160 Hepatitis C
    102282466
   05171 Coronavirus disease - COVID-19
    102282466
   05164 Influenza A
    102282466
   05162 Measles
    102282466
   05168 Herpes simplex virus 1 infection
    102282466
   05163 Human cytomegalovirus infection
    102282466
   05167 Kaposi sarcoma-associated herpesvirus infection
    102282466
   05169 Epstein-Barr virus infection
    102282466
   05165 Human papillomavirus infection
    102282466
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102282466
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102282466
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102282466
SSDB
Motif
Pfam: Interferon Sigma70_ner
Other DBs
NCBI-GeneID: 102282466
NCBI-ProteinID: XP_005898560
UniProt: L8ID59
LinkDB
Position
Un
AA seq 187 aa
MTYYRCLLPMVLLLCFSTTALSRSYSLLRFQQRRSAEVCQKLLGQLPSTPQHCLEARMDF
QVPEEMNQAQQFRKEDAILVIYEMLQQIFNILTRDFSSTGWSETIIEDLLEELYEQMNRL
EPIEKEIMQKQNSTMGDTTVLHLRKYYFNLVQYLKFKEYNRCAWTVVRVQILRNFSFLTR
LTGYLHD
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacctattaccggtgcctcctcccgatggttctcctgctgtgtttctccaccacagct
ctttccaggagctacagcttgctccgattccagcaaaggcggagcgctgaggtgtgtcag
aaactcctggggcagttaccttcaacgcctcaacattgcctcgaggccaggatggacttc
caggtccctgaggagatgaaccaagcacagcagttccggaaggaagatgccatattggtc
atctatgagatgctccagcagatcttcaatattctcaccagagacttctccagcacgggc
tggtctgagaccatcattgaggacctccttgaggaactctatgagcaaatgaatcgtttg
gagccaatcgagaaggaaataatgcagaagcaaaactccactatgggagacacaaccgtt
cttcacctgaggaaatattacttcaacctcgtgcagtacctgaagttcaaggagtacaac
aggtgtgcctggacagtcgtacgagtgcaaatactcaggaatttttcttttctgacgaga
ctaacaggttacctccatgactga

KEGG   Bos mutus (wild yak): 102282615
Entry
102282615         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102282615
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102282615
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102282615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102282615
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102282615
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102282615
NCBI-ProteinID: XP_005910334
LinkDB
Position
Un
AA seq 195 aa
MGVLIAVSHKLVCVTXGPGGSLGCDLSQNHVLVGRENLRFLGQMRRLSPRFCLQDRKDFA
FPQEMVEGSQLQEAQAFSVLHEMLQQTFNLFNTERSSAAWDTTLLEQLRTGLHQQLNELD
ACLGQVMGEEDSVLGRMGPTLAMKRYFQGIHVYLQEKEYSDCAWEIVRLEIMRFLSSSTS
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggagttctgattgctgtctcccataagctagtgtgtgtgacnnnnggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcagggagaacctcaggttc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcagccagctccaggaggcccaggccttctctgtgctc
cacgagatgctgcagcagaccttcaaccttttcaacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctgaacgaactggat
gcctgcctggggcaggtgatgggagaggaagactctgtcctgggaaggatgggccccaca
ctggccatgaagaggtacttccagggcatccatgtctacctgcaagagaaggaatacagc
gactgcgcctgggaaatcgtcagactagaaatcatgagattcttgtcttcatcaaccagc
ttgcaagaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102282896
Entry
102282896         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102282896
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102282896
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102282896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102282896
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102282896
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102282896
NCBI-ProteinID: XP_005910335
UniProt: L8HP91
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLGSYGPGGSLGCDLSQNHVLVGRENLRFLGQMRRLSPRFCLQDRKDFA
FPQEMVEGGQLQEAQAISVLHEMLQQTFNLFNTERSSAAWDTTLLEQLRTGLHQQLDDLD
ACLGTVTGEEDSALGRTGPTLAVKRYFQGIHVYLKEKEYSDCAWEIVRVEIMRSLSSSTN
LQERLRVMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctcgtgctgggcagctacggcccgggagga
tccctgggctgtgacctgtctcagaaccacgtgctggttggcagggagaacctcaggttc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggaaggtggccagctccaggaggcccaggccatctctgtgctc
cacgagatgctgcagcagaccttcaaccttttcaacacagagcgctcctctgctgcctgg
gacaccaccctcctggagcagctccgcactggactccatcagcagctggacgacctggac
gcctgcctgggcacagtgacaggagaggaagactctgccctgggaaggacgggccccaca
ctggccgtgaagaggtacttccagggcatccatgtctacctgaaagagaaggaatacagc
gactgtgcctgggaaattgtcagagtggaaatcatgagatccttgtcttcatcaaccaac
ttgcaagaaaggttaagagtgatggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102283689
Entry
102283689         CDS       T02919                                 

Gene name
IL12B
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04620  Toll-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04940  Type I diabetes mellitus
bom05133  Pertussis
bom05134  Legionellosis
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05143  African trypanosomiasis
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05162  Measles
bom05164  Influenza A
bom05168  Herpes simplex virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05321  Inflammatory bowel disease
bom05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283689 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102283689 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102283689 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    102283689 (IL12B)
   04625 C-type lectin receptor signaling pathway
    102283689 (IL12B)
   04658 Th1 and Th2 cell differentiation
    102283689 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283689 (IL12B)
   05205 Proteoglycans in cancer
    102283689 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102283689 (IL12B)
   05330 Allograft rejection
    102283689 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102283689 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102283689 (IL12B)
   05134 Legionellosis
    102283689 (IL12B)
   05152 Tuberculosis
    102283689 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102283689 (IL12B)
   05164 Influenza A
    102283689 (IL12B)
   05162 Measles
    102283689 (IL12B)
   05168 Herpes simplex virus 1 infection
    102283689 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102283689 (IL12B)
   05145 Toxoplasmosis
    102283689 (IL12B)
   05140 Leishmaniasis
    102283689 (IL12B)
   05142 Chagas disease
    102283689 (IL12B)
   05143 African trypanosomiasis
    102283689 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102283689 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102283689 (IL12B)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102283689 (IL12B)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102283689 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 Ig_3 fn3 Ig_2 I-set
Other DBs
NCBI-GeneID: 102283689
NCBI-ProteinID: XP_005897575
UniProt: L8IF31
LinkDB
Position
Un
AA seq 327 aa
MHPQQLVVSWFSLVLLASPIVAMWELEKNVYVVELDWYPDAPGETVVLTCDTPEEDGITW
TSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSRSLLLLHKKEDGIWSTDILKDQ
KEPKAKSFLKCEAKDYSGHFTCWWLTAISTDLKFSVKSSRGSSDPRGVTCGAASLSAEKV
SVEHREYNKYTVECQEGSACPAAEESLLIEVVVEAVHKLKYENYTSSFFIRDIIKPDPPK
NLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFMDQTSAKVTCH
KDANVRVQARDRYYSSFWSEWASVSCS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcaccctcagcagttggtcgtttcctggttttccctggttttgctggcatctcccatc
gtggccatgtgggaactggagaaaaatgtttatgttgtagaattggattggtatcctgat
gctcctggagaaacagtggtcctcacgtgtgacactcctgaagaagacggcatcacctgg
acctcagaccagagcagtgaggtcttgggctctggcaaaaccttgaccatccaagtcaaa
gagtttggagatgctgggcagtacacctgtcacaaaggaggcgaggctctgagtcgttca
ctcctcctgctgcacaaaaaggaagatggaatttggtccactgatattttaaaggatcag
aaagaacccaaagctaagagttttttaaaatgtgaggcaaaggattattctggacacttc
acctgctggtggctgacagcaatcagtactgatttgaaattcagtgtcaaaagcagcaga
ggctcctctgacccccgaggggtgacgtgcggagcagcgtcgctctcagcagagaaggtc
agcgtggagcacagggagtataacaagtacacagtggagtgtcaggagggcagcgcctgc
ccagccgccgaggagagcctgcttattgaggtcgtggtagaagccgtgcacaagctcaag
tatgaaaactacaccagcagcttcttcatcagggacatcatcaaaccagacccacccaag
aacctgcaactgagaccattaaagaattctcggcaggtggaggtcagctgggagtaccct
gacacgtggagcacccctcattcctacttctccctgacgttttgtgttcaggtccaggga
aagaacaagagagaaaagaaactcttcatggaccaaacctcagccaaagtcacatgccac
aaggatgccaatgtccgcgtgcaagcccgggaccgctactacagctcattctggagtgaa
tgggcatctgtgtcctgcagttag

KEGG   Bos mutus (wild yak): 102284300
Entry
102284300         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284300
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284300
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102284300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102284300
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102284300
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 102284300
NCBI-ProteinID: XP_005910614
UniProt: L8HMC7
LinkDB
Position
Un
AA seq 195 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHMLVGRKNLRLLGQMRRLSSRFCLQDRKDFT
FPQEMVEGSQLQEAQAISVLHEMLQQSFNLFHTERSSAAWDTTLLEQLHTGLHQQLDDLD
ACLGQGMEEEDPALGRTGPTLAVKRYFQGIHVYLKEKEYSDCAWEIVRLEIMRALSSSTS
LQERLRMMDGDLNSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacggcccaggagga
tccctgggctgtgacctgtctcagaaccacatgctggttggcaggaagaaccttaggctc
ctgggccaaatgaggagactgtcctctcgcttctgtctgcaagacagaaaagacttcact
ttcccccaggagatggtggagggcagccagctccaggaggcccaggccatctctgtgctc
cacgagatgctccagcagagcttcaacctcttccacacagaacgctcctctgctgcctgg
gacaccaccctcctggagcagctccacactggactccatcagcagctggacgacctggac
gcctgcctggggcaggggatggaagaggaagacccggccctgggaaggacgggccccaca
ctggccgtgaagaggtacttccagggcatccatgtctacctgaaagagaaggaatacagt
gactgcgcctgggaaatcgtcagactggaaatcatgagagccttgtcttcatcaaccagc
ttgcaagaaaggttaagaatgatggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102284581
Entry
102284581         CDS       T02919                                 

Definition
(RefSeq) interferon beta-2
  KO
K05415  interferon beta
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04668  TNF signaling pathway
bom05135  Yersinia infection
bom05142  Chagas disease
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284581
   04668 TNF signaling pathway
    102284581
   04151 PI3K-Akt signaling pathway
    102284581
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284581
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102284581
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102284581
   04621 NOD-like receptor signaling pathway
    102284581
   04622 RIG-I-like receptor signaling pathway
    102284581
   04623 Cytosolic DNA-sensing pathway
    102284581
   04650 Natural killer cell mediated cytotoxicity
    102284581
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102284581
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102284581
   05152 Tuberculosis
    102284581
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102284581
   05161 Hepatitis B
    102284581
   05160 Hepatitis C
    102284581
   05171 Coronavirus disease - COVID-19
    102284581
   05164 Influenza A
    102284581
   05162 Measles
    102284581
   05168 Herpes simplex virus 1 infection
    102284581
   05163 Human cytomegalovirus infection
    102284581
   05167 Kaposi sarcoma-associated herpesvirus infection
    102284581
   05169 Epstein-Barr virus infection
    102284581
   05165 Human papillomavirus infection
    102284581
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102284581
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102284581
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102284581
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102284581
NCBI-ProteinID: XP_005910615
UniProt: L8HQW6
LinkDB
Position
Un
AA seq 186 aa
MTHRCLLQMVLLLCFSTTALPRSYSLLGLQERRSAAVSQKLLWQLPSTPQRCLEARMDFQ
MPEEMKQAQQFQKEDAILVMYEMLQQIFGILTRDFSSTGWSETIIEDLLVELYGQMNRLQ
PIQKEIMQKKNFTMGNTTVLHLKKYYLNLMYYLKSKEYNRCAWTVVRVQILTNFSFLKSL
TAYLRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgacccaccggtgcctcctccagatggttctcctgctgtgtttctccaccacagctctt
cccaggagctacagcttgcttggattgcaagaaaggcggagtgctgcggtctctcagaaa
ctcctgtggcagttaccttcaactcctcaacgttgcctcgaggccaggatggatttccag
atgcctgaggagatgaagcaagcacagcagttccagaaggaagatgccatattggtcatg
tatgagatgctccagcagatctttggcattctcaccagagatttctccagcactggctgg
tctgagaccatcatcgaggacctccttgtggaactctatgggcagatgaatcgtctgcag
ccaatccagaaggaaataatgcagaagaaaaacttcactatgggaaacacaaccgttctt
cacctgaagaaatattacctcaacctcatgtactacctgaagtccaaggagtacaacagg
tgtgcctggacagtcgtgcgagtgcaaatactcacgaacttttctttcctgaagagccta
acagcttacctccgtgactga

KEGG   Bos mutus (wild yak): 102284743
Entry
102284743         CDS       T02919                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284743 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284743 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102284743 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102284743 (IFNE)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102284743 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102284743
NCBI-ProteinID: XP_005887920
LinkDB
Position
Un
AA seq 193 aa
MINKAFFEIVLVLLAYSTVCSQELKLVLCQQRRVNQESLKLLNKLQTSSVQQCLPHRKHF
LLPQKSVNPHQYQKGQVLAILHEMLQQIFSLFRAIVSLDGWEESHTEKFLVELHQQLEYL
EALMRLQAKQKSDTLGSENLRLQVKMYFQRIHDYLESQDYSSCAWTIVQVEINRCLFLVF
RLTRKLSEQGMET
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattaacaaggctttctttgaaattgtgttggttctgttggcttattccactgtttgc
tcccaagagctgaaactggttctttgccagcaaaggagagtgaaccaagagagtttaaaa
cttttgaataaactgcagacctcgtcagttcagcagtgtctaccacacaggaaacacttc
ctgcttccccagaagtctgtgaatcctcaccagtatcagaaaggacaagtactggccatt
cttcatgagatgcttcaacagatcttcagcctcttcagggcaattgtatctctggatggt
tgggaggaaagtcacacagaaaagttccttgttgaacttcatcaacagctggaataccta
gaagcactcatgagactgcaagcaaagcagaaaagtgacaccttgggcagtgagaacctt
agattacaggttaaaatgtatttccaaaggatccatgattacctggaaagccaggactat
agcagctgtgcctggactattgtccaagtggaaatcaaccggtgtctgttcttggtattc
cgactcacaagaaagctgagtgaacagggcatggaaacttga

KEGG   Bos mutus (wild yak): 102284869
Entry
102284869         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102284869
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102284869
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102284869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102284869
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102284869
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 102284869
NCBI-ProteinID: XP_005910616
LinkDB
Position
Un
AA seq 116 aa
MAVMLSLLMALVLVSYGLGGSLGCDLSQNHMLVGRQNLRLLGQMRRLSPRFCLQDRKDFA
FPQEVVEGSQLQEAQAFSVLHEMLQQTFNLFNTEHSSAAWDTTLLEPLHTGLHDRG
NT seq 351 nt   +upstreamnt  +downstreamnt
atggccgtcatgctctctctactgatggccctggtgcttgtcagctacggcctgggagga
tccctgggctgtgacctgtctcagaaccacatgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagactttgct
ttcccccaggaggtggtggagggtagccagctccaggaggctcaggccttctctgtgctc
cacgagatgctccagcagaccttcaaccttttcaacacagagcactcctctgctgcctgg
gacaccaccctcctggagccgctccacactggactccacgacagaggatga

KEGG   Bos mutus (wild yak): 102285417
Entry
102285417         CDS       T02919                                 

Definition
(RefSeq) interferon alpha-H-like
  KO
K05414  interferon alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102285417
   04151 PI3K-Akt signaling pathway
    102285417
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102285417
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102285417
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102285417
   04621 NOD-like receptor signaling pathway
    102285417
   04622 RIG-I-like receptor signaling pathway
    102285417
   04623 Cytosolic DNA-sensing pathway
    102285417
   04650 Natural killer cell mediated cytotoxicity
    102285417
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102285417
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102285417
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102285417
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102285417
   05161 Hepatitis B
    102285417
   05160 Hepatitis C
    102285417
   05171 Coronavirus disease - COVID-19
    102285417
   05164 Influenza A
    102285417
   05162 Measles
    102285417
   05168 Herpes simplex virus 1 infection
    102285417
   05163 Human cytomegalovirus infection
    102285417
   05167 Kaposi sarcoma-associated herpesvirus infection
    102285417
   05169 Epstein-Barr virus infection
    102285417
   05165 Human papillomavirus infection
    102285417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102285417
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102285417
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102285417
NCBI-ProteinID: XP_014338722
LinkDB
Position
Un
AA seq 168 aa
MAPAWSFLLSLLLFSCNAICSLGCHLPHSYSLPNRRVLMLLRQLRRVSPSSCLQDRNDFA
FPQEVLGSSQLQKAQAISVLHEVTQHTFQLFSTEGSAATWDESLLDKLHAALDQQLTDLQ
ACLRQEEGLRGAPLLKEDASLAVRKYFHRITLYLREKRQPGRLSEQKS
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctgtccctgctgctgttcagctgcaatgccatctgc
tctctgggctgccacctgcctcactcctacagcctgcccaacaggagggtcctgatgctc
ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccacaggaggtgctgggtagcagccagctgcaaaaggctcaagccatctctgtgctc
cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggctgccacgtgg
gacgagagcctcctggacaagctccacgctgcactggaccagcagcttactgacctgcaa
gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggatgccagc
ctggctgtgaggaaatacttccacagaatcactctctatctgcgagagaagagacaacct
gggaggttgtcagagcagaagtcatga

KEGG   Bos mutus (wild yak): 102285705
Entry
102285705         CDS       T02919                                 

Definition
(RefSeq) interferon tau
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102285705
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102285705
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102285705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102285705
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102285705
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102285705
NCBI-ProteinID: XP_005910617
LinkDB
Position
Un
AA seq 143 aa
MFPEKNQDSGGEMGEGSQLHEAQAISVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGL
HQQLDDLDACLGQVMGEEDSALGRTGPTLAVKGYFQGIHVYLQEKEYSDCAWEIVRVEMM
RALSSSTSLQERLRKMGGDLNSP
NT seq 432 nt   +upstreamnt  +downstreamnt
atgttccctgagaagaaccaggattctggtggggagatgggggagggcagccagctccat
gaggcccaggccatctctgtgctccacgagatgctccagcagaccttcaacctcttccac
acagagcgctcctctgctgcctgggacaccaccctcctggagcagctccgcactggactc
catcagcagctggacgacctggatgcctgcctggggcaggtgatgggagaggaagactct
gccctgggaaggacgggccccacactagctgtgaaggggtacttccagggaatccatgtc
tacctgcaagagaaggaatacagcgactgcgcctgggaaatcgtcagagtggagatgatg
agagccctctcgtcatcaaccagcttgcaagaaaggttaagaaagatgggtggagatctg
aactcaccttga

KEGG   Bos mutus (wild yak): 102285740
Entry
102285740         CDS       T02919                                 

Gene name
IL21
Definition
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102285740 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102285740 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102285740 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    102285740 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102285740 (IL21)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102285740 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 102285740
NCBI-ProteinID: XP_005899795
LinkDB
Position
Un
AA seq 164 aa
MRSTPGNMERIVICLMVIFSGTVAHKSSFQGQDRLFIRLRQLIDIVDQLKNYVNDLDPEF
LPAPEDVKRHCERSAFSCFQKVQLKSANNGDNEKIINILTKQLKRKLPATNAGRRQKHEV
TCPSCDSYEKKPPKEYLERLKSLIQKVYNKLHLIFYFILTQMAS
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagatccactcctggcaacatggagagaatagtcatttgcctgatggtcatcttctct
gggacagtggcccataagtcaagcttccaagggcaagatcgcctctttattagactgcgt
caacttatagacattgttgatcagctgaaaaactatgtgaatgacttggatcctgaattt
ctgccagctccagaagatgtaaagagacactgtgagcggtcagctttttcatgttttcag
aaggttcaactaaagtcagcaaataatggagacaacgaaaagataatcaacatattaact
aaacagctgaagaggaaactacctgccacaaatgcagggagaagacagaaacatgaagta
acatgtccttcttgtgattcttatgagaaaaaaccacccaaggaatacctagaaagactg
aaatcactcatccaaaaggtatataacaaattacatttgattttctatttcatccttacc
cagatggcgtcttaa

KEGG   Bos mutus (wild yak): 102285750
Entry
102285750         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102285750
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102285750
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102285750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102285750
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102285750
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102285750
NCBI-ProteinID: XP_005903836
UniProt: L8I2T9
LinkDB
Position
Un
AA seq 198 aa
MAFVLSLLMALVLVSYGPGGSLGCDLSQNHVLVGRQNLRLLGQMRRLSPRFCLQDRKHFA
FPQCPQEMGEGSQLHEAQAFSVLHEMLQQTFNLFHTERSSAAWDTTLLEQLRTGLHQQLD
DLDACLGQVMGEEDSTLGRTGPTLAMKRYFQGIHVYLKENQYSDCAWEIVRVEIMRSFSS
STNLQERLRMMDGDLSSP
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcgtttgtgctctctctactgatggccctggtgctggtcagctacggcccgggagga
tccctgggctgtgacttgtctcagaaccacgtgctggttggcaggcagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaacacttcgct
ttcccccagtgcccccaggagatgggggagggcagccagctccatgaggcccaggccttc
tctgtgctccacgagatgctccagcagaccttcaacctcttccacacagagcgctcctct
gctgcctgggacaccaccctcctggaacagctccgcactggactccatcagcagctcgat
gacctggacgcctgcctggggcaagtgatgggagaggaagactctaccctgggaaggacg
ggccccacactggccatgaagaggtatttccaaggcatccatgtctacctgaaagagaac
caatacagcgattgtgcctgggaaatcgtcagagtggaaatcatgagatccttctcttca
tcaaccaacttgcaagaaaggttaagaatgatggatggagacctgagctcaccttga

KEGG   Bos mutus (wild yak): 102286313
Entry
102286313         CDS       T02919                                 

Definition
(RefSeq) interferon alpha-A
  KO
K05414  interferon alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04217  Necroptosis
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286313
   04151 PI3K-Akt signaling pathway
    102286313
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102286313
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102286313
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102286313
   04621 NOD-like receptor signaling pathway
    102286313
   04622 RIG-I-like receptor signaling pathway
    102286313
   04623 Cytosolic DNA-sensing pathway
    102286313
   04650 Natural killer cell mediated cytotoxicity
    102286313
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286313
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102286313
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102286313
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102286313
   05161 Hepatitis B
    102286313
   05160 Hepatitis C
    102286313
   05171 Coronavirus disease - COVID-19
    102286313
   05164 Influenza A
    102286313
   05162 Measles
    102286313
   05168 Herpes simplex virus 1 infection
    102286313
   05163 Human cytomegalovirus infection
    102286313
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286313
   05169 Epstein-Barr virus infection
    102286313
   05165 Human papillomavirus infection
    102286313
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102286313
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102286313
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102286313
NCBI-ProteinID: XP_005903837
LinkDB
Position
Un
AA seq 189 aa
MAPAWSFLLALLLLSCNAICSLDCHLPHTLSLANRRVLMLLQQLRRVSPSSCLQDRNDFA
FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDMQ
ACLRQEEGLQGAPLLKEDSSLAVRKYFHRLTLYLREKRHSPCAWEVVRAEVMRAFSSSTN
LQESFRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc
tctctggactgccacctgcctcacaccctcagcctggccaacaggagggtcctgatgctc
ctgcaacaactgagaagggtctccccttcctcctgcctgcaggacagaaatgacttcgca
ttcccccaggaggctctgggtggcagccagttgcagaaggctcaagccatctctgtgctc
catgaggtgacccagcacaccttccagctcttcagcacagagggctcgcccgccacgtgg
gacaagagcctcctggacaagctacgcgctgcgctggatcagcagctcactgacatgcaa
gcctgtctgaggcaggaggaggggctgcaaggggctcccctgctcaaggaggactccagc
ctggctgtgaggaaatacttccacagactcactctctatcttcgagagaagagacacagc
ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac
ttgcaggagagtttcaggagaaaggactga

KEGG   Bos mutus (wild yak): 102286595
Entry
102286595         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286595
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102286595
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102286595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102286595
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   102286595
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102286595
NCBI-ProteinID: XP_014336296
LinkDB
Position
Un
AA seq 150 aa
MAFVLSLLMALVLVSYSSGGSLGCDLSQNHAISVLHEMLQQTFNLFHTERSSAAWDTTLL
EQLRTGLHQQLDDLDACLGPVTGEEDSALGRMSPTLAVKRYFQGIHVYLKEKEYSDCAWE
IVRVEIMRSLSSSTSLQERLRMMDGDLNSP
NT seq 453 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctacagctctggagga
tccctgggctgtgacctgtctcagaaccacgccatctctgtgctccatgagatgctccag
cagaccttcaacctcttccacacagagcgctcctctgctgcctgggacaccaccctcctg
gagcagctccgcactggactccatcagcagctggatgacctggacgcctgcttgggccca
gtgacgggagaggaagactctgccctgggaaggatgagccccacactggccgtgaagagg
tacttccagggaatccatgtctacctgaaagagaaggaatacagcgactgtgcctgggaa
atcgtcagagtggaaatcatgagatccttgtcttcatcaaccagcttgcaagaaaggtta
agaatgatggatggagacctgaactcaccttga

KEGG   Bos mutus (wild yak): 102286767
Entry
102286767         CDS       T02919                                 

Gene name
IL7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04151  PI3K-Akt signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102286767 (IL7)
   04151 PI3K-Akt signaling pathway
    102286767 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102286767 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102286767 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286767 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102286767 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102286767 (IL7)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102286767 (IL7)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Cytokines
   102286767 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 102286767
NCBI-ProteinID: XP_005898641
LinkDB
Position
Un
AA seq 176 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDISGKDGGAYQNVLMVNIDDLDNMINFDSNCLN
NEPNFFKKHSCDDNKEASFLNRASRKLRQFLKMNISDDFKLHLSTVSQGTLTLLNCTSKG
KGRKPPSLSEAQPTKNLEENKSSKEQKKQNDLCFLKILLQKIKTCWNKILRGIKEH
NT seq 531 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattagtggtaaagacggtggagcatatcagaatgtt
ctaatggtcaacatcgatgacttggacaacatgataaactttgatagcaattgcctgaat
aacgaacctaacttttttaaaaaacattcatgtgatgataataaggaagcttcatttttg
aatcgtgcttctcgaaagttgaggcaattccttaaaatgaatatcagtgacgatttcaag
cttcacctatcaacagtttcacagggcacattaacactgctgaactgcaccagcaagggt
aaaggaagaaaaccaccttccctgagtgaagctcaacccactaagaatttggaagagaat
aaatcttcaaaggaacagaaaaaacagaatgacctgtgtttcctaaagatactactacaa
aagataaaaacttgttggaataaaattttgaggggcattaaagaacactga

KEGG   Bos mutus (wild yak): 102287919
Entry
102287919         CDS       T02919                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01523  Antifolate resistance
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04640  Hematopoietic cell lineage
bom04657  IL-17 signaling pathway
bom04659  Th17 cell differentiation
bom04668  TNF signaling pathway
bom04672  Intestinal immune network for IgA production
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05010  Alzheimer disease
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05133  Pertussis
bom05134  Legionellosis
bom05135  Yersinia infection
bom05142  Chagas disease
bom05143  African trypanosomiasis
bom05144  Malaria
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05321  Inflammatory bowel disease
bom05323  Rheumatoid arthritis
bom05332  Graft-versus-host disease
bom05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102287919 (IL6)
   04668 TNF signaling pathway
    102287919 (IL6)
   04066 HIF-1 signaling pathway
    102287919 (IL6)
   04068 FoxO signaling pathway
    102287919 (IL6)
   04151 PI3K-Akt signaling pathway
    102287919 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102287919 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102287919 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102287919 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102287919 (IL6)
   04620 Toll-like receptor signaling pathway
    102287919 (IL6)
   04621 NOD-like receptor signaling pathway
    102287919 (IL6)
   04623 Cytosolic DNA-sensing pathway
    102287919 (IL6)
   04625 C-type lectin receptor signaling pathway
    102287919 (IL6)
   04659 Th17 cell differentiation
    102287919 (IL6)
   04657 IL-17 signaling pathway
    102287919 (IL6)
   04672 Intestinal immune network for IgA production
    102287919 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102287919 (IL6)
   05202 Transcriptional misregulation in cancer
    102287919 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102287919 (IL6)
   05321 Inflammatory bowel disease
    102287919 (IL6)
   05332 Graft-versus-host disease
    102287919 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102287919 (IL6)
   05020 Prion disease
    102287919 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    102287919 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102287919 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102287919 (IL6)
   04931 Insulin resistance
    102287919 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102287919 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102287919 (IL6)
   05135 Yersinia infection
    102287919 (IL6)
   05133 Pertussis
    102287919 (IL6)
   05134 Legionellosis
    102287919 (IL6)
   05152 Tuberculosis
    102287919 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102287919 (IL6)
   05161 Hepatitis B
    102287919 (IL6)
   05171 Coronavirus disease - COVID-19
    102287919 (IL6)
   05164 Influenza A
    102287919 (IL6)
   05162 Measles
    102287919 (IL6)
   05168 Herpes simplex virus 1 infection
    102287919 (IL6)
   05163 Human cytomegalovirus infection
    102287919 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102287919 (IL6)
   05169 Epstein-Barr virus infection
    102287919 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102287919 (IL6)
   05144 Malaria
    102287919 (IL6)
   05142 Chagas disease
    102287919 (IL6)
   05143 African trypanosomiasis
    102287919 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102287919 (IL6)
   01523 Antifolate resistance
    102287919 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102287919 (IL6)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interleukins
   102287919 (IL6)
SSDB
Motif
Pfam: IL6 MAP65_ASE1 IL23 GCSF ADIP Lipoprotein_6
Other DBs
NCBI-GeneID: 102287919
NCBI-ProteinID: XP_005901311
LinkDB
Position
Un
AA seq 208 aa
MNSRFTSAFTPFAVSLGLLLVMTSXXXTPGPLGEDFKNDTTPGRLLLTTPEKTEALIKRM
VDKISAMRKEICEKNDECENSKETLAENKLNLPKMEEKDGCFQSGFNQAICLIRTTAGLL
EYQIYLDYLQNEYEGNQENVRDLRKNIRTLIQILKQKIADLITTPATNTDLLEKMQSSNE
WVKNAKIILILRNLENFLQFSLRAIRMK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaattcccgcttcacaagcgccttcactccattcgctgtctccctggggctgctcctg
gtgatgacttcnnnnnnnnctaccccgggtcccctgggagaagatttcaaaaatgacacc
accccaggcagactacttctgaccactccagagaaaaccgaagctctcattaagcgcatg
gtcgacaaaatctctgcaatgagaaaggagatatgtgagaagaatgacgagtgtgaaaac
agcaaggagacactggcagaaaataagctgaatcttccaaaaatggaggaaaaggacgga
tgcttccaatctgggttcaatcaggcgatttgcttgatcagaaccactgctggtcttctg
gagtatcagatatacctggactacctccagaacgagtatgagggaaatcaggaaaatgtc
agggatttgaggaaaaatatcagaacactgatccagatcctgaagcaaaagatcgcagat
ctaataaccactccagccacaaacactgacctgctggagaagatgcagtcttcaaacgag
tgggtaaagaacgcaaagattatcctcatcctgagaaaccttgagaatttcctgcagttc
agcctgagagctattcggatgaagtag

KEGG   Bos mutus (wild yak): 106701499
Entry
106701499         CDS       T02919                                 

Definition
(RefSeq) cardiotrophin-2-like
  KO
K24382  cardiotrophin 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106701499
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106701499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    106701499
Cytokines and growth factors [BR:bom04052]
 Cytokines
  CSF and other factors
   106701499
SSDB
Motif
Pfam: PRF CNTF
Other DBs
NCBI-GeneID: 106701499
NCBI-ProteinID: XP_014338117
LinkDB
Position
Un
AA seq 125 aa
MPFEIWHGLEDEVRLSLTQEAFWSFSQHFRIAMVDQHILHRGDSIVEDQLWEARLKAKGL
AGNLAAIMTSLGLPSPAANTPLGPVPLGDSAYRKKCRGYVIIRDYSFWTDRAVTFLGELK
AKYSQ
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcccttcgagatctggcatggcctggaagatgaagtacgtctgagcctcacccaggag
gccttctggtccttcagccagcacttccggattgcgatggttgaccagcatatcctccac
cgtggcgattccatcgtggaggatcagctttgggaagcaagactcaaggccaaaggccta
gcgggcaacttggctgccatcatgacttctctgggcctgcccagccccgcagcaaacacc
cccctcggtcctgtccccttaggggactcggcctaccgcaagaagtgtcgagggtatgta
ataatccgggactacagcttttggacagaccgagctgtgactttcttgggtgagctcaag
gctaaatactctcaatag

KEGG   Bos mutus (wild yak): 106701613
Entry
106701613         CDS       T02919                                 

Definition
(RefSeq) interferon omega-1-like
  KO
K05440  interferon omega
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04622  RIG-I-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106701613
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106701613
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    106701613
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    106701613
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Interferons
   106701613
SSDB
Motif
Pfam: Interferon DIRP
Other DBs
NCBI-GeneID: 106701613
NCBI-ProteinID: XP_014338776
LinkDB
Position
Un
AA seq 134 aa
MAFVLSLLMALVLVSYGLGGSLGCDLSPNHVLVGRKNLRLLGQMRRLSPRFCLQDRKDFA
FPQEMVEGSQLQEAQAFSVLHEMLQQHGIHVYLQEKEYSNCAWEIVRLEIMRSFSLATSL
QERLRMKDGDPNSP
NT seq 405 nt   +upstreamnt  +downstreamnt
atggccttcgtgctctctctactgatggccctggtgctggtcagctatggcctgggagga
tccctgggctgtgacctgtctccgaaccacgtgctcgttggcaggaagaacctcaggctc
ctgggccaaatgaggagactctcccctcgcttctgtctgcaggacagaaaagacttcgct
ttcccccaggagatggtggagggcagccagctccaggaggcccaggccttctctgtgctc
cacgagatgctgcagcagcacggcatccatgtctacctgcaagagaaggaatacagcaac
tgtgcctgggaaatcgtcagactggaaatcatgagatccttctctttagcaaccagcttg
caagaaaggttaagaatgaaggatggagacccgaactcaccttga

DBGET integrated database retrieval system