KEGG   Bos mutus (wild yak): 102264880
Entry
102264880         CDS       T02919                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04024  cAMP signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04310  Wnt signaling pathway
bom04330  Notch signaling pathway
bom04350  TGF-beta signaling pathway
bom04520  Adherens junction
bom04630  JAK-STAT signaling pathway
bom04720  Long-term potentiation
bom04916  Melanogenesis
bom04919  Thyroid hormone signaling pathway
bom04922  Glucagon signaling pathway
bom04935  Growth hormone synthesis, secretion and action
bom05016  Huntington disease
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05206  MicroRNAs in cancer
bom05211  Renal cell carcinoma
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102264880 (CREBBP)
   04330 Notch signaling pathway
    102264880 (CREBBP)
   04350 TGF-beta signaling pathway
    102264880 (CREBBP)
   04630 JAK-STAT signaling pathway
    102264880 (CREBBP)
   04066 HIF-1 signaling pathway
    102264880 (CREBBP)
   04068 FoxO signaling pathway
    102264880 (CREBBP)
   04024 cAMP signaling pathway
    102264880 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102264880 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102264880 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102264880 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    102264880 (CREBBP)
   04919 Thyroid hormone signaling pathway
    102264880 (CREBBP)
   04916 Melanogenesis
    102264880 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    102264880 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102264880 (CREBBP)
   05206 MicroRNAs in cancer
    102264880 (CREBBP)
   05203 Viral carcinogenesis
    102264880 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102264880 (CREBBP)
   05215 Prostate cancer
    102264880 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102264880 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102264880 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102264880 (CREBBP)
   05161 Hepatitis B
    102264880 (CREBBP)
   05164 Influenza A
    102264880 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102264880 (CREBBP)
   05165 Human papillomavirus infection
    102264880 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102264880 (CREBBP)
   03036 Chromosome and associated proteins [BR:bom03036]
    102264880 (CREBBP)
   03029 Mitochondrial biogenesis [BR:bom03029]
    102264880 (CREBBP)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102264880 (CREBBP)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102264880 (CREBBP)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102264880 (CREBBP)
Mitochondrial biogenesis [BR:bom03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102264880 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102264880
NCBI-ProteinID: XP_014335459
LinkDB
Position
Un
AA seq 2251 aa
MAENVLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPAQQGLGGQAQGQPSSTNMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHGLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQAGGMSKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNASVTNVPNMPQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRSLNPLGNNPMNIPAGGITTDQ
QPSNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPAAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALSAPGTQPPGIPQAQPVRPPNGPMPLTVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NSMMAQAPAQSQFLPQSQFPSSSGALSVSSVGMGQPAAQTGVPQVLSIVLVNSFLVGPQV
SRLPPPFTHPPLHQTPPPASTAAGMPSLQHPAAPGVTPPQPAAPTQPSTPASSSGQTPTP
TPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGTPL
SQTAASIDNRVPTPSSVASAETNSQQPGPEVPLLEMKAEIKTEDTEPDAGEPKGEPGATM
MEEDLQGSSQVKEETDPTEQKSEPMEVDEKKTEVKVEAKEEEEGSTNGTASQSTSPSQPR
KKIFKPEELRQALMSTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRK
LDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCG
RKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTT
ISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRTRKE
NKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVD
SGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFR
PRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQE
WYKKMLDKAFAERIIHDYKDILKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEE
ERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRTNKKKPSMPNVSNDLSQKL
YATMEKHKEVFFVIHLHAGPVIHTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSL
RRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHK
CQCRNANGSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPF
CLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPQPMPGMPRPVMS
MQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFI
KQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNAMQASGPRPGVPPQQQAMGGLNPQ
GQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQGSAGMAGGMAGHSQ
FQQPPGPAGYPPAMPQQRMQQHLPMQGSAMGPMAAQMGQLGQMGQPGLGADSTPNIQQAL
QQRILQQQQMKQQMGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPAPVQS
PRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQ
LNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 6756 nt   +upstreamnt  +downstreamnt
atggccgagaacgtgctggacggcccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagttgatccccaatggaggagaattaagccttttaaacagtgggaacctcgtt
ccagatgctgcttccaaacataaacaactgtccgagctcctgcgaggcggcagcagctcc
agcatcaacccgggaataggcaatgtgagtgccagcagccccgcgcagcaaggcctcggc
ggccaggcccaggggcagcccagcagtaccaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttccgcccccagcctgcctaagcaggcagccagcacc
tccgggcccactcctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaacgcaaac
ttcaaccagacccacccaggcctcctcaatagtaactctggccacggtttaatgaaccag
gcccagcaaggacaggcgcaggttatgaatggatctctcggggctgctggccgaggaagg
ggagctgggatgccataccctactccggccatgcagggggccacaagcagtgtgctggct
gagacgttgacccaagtttcaccgcaaatggccagtcacgcagggctgaacaccgcacag
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagcccctggagtgaaccctcagctgccgagcaag
cagagcatggtcaacagcttgcctccgtttgccgcagacatcaagaacgcttcagtcacc
aacgtgccaaacatgcctcagatgcaaacatcagtgggaattgtacccacccaggcgatt
gcaacgggccccaccgcagatcccgaaaaacgcaaactgatacagcagcagctggtccta
ctgcttcacgctcataaatgccagaggcgagaacaagccaatggagaggtccgggcctgc
gcactcccacattgtcggaccatgaaaaacgtcttgaatcacatgacgcattgtcaggct
gggaaggcttgtcaagttgcccattgcgcatcttcacgacaaatcatctctcattggaag
aactgcacacggcatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacaccattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatccgatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggagt
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccatcaaacttgatttcagaatcagctcttccaacttcccttggggctacaaacccc
ctgatgaatgacggctcaaactctggaaacattggcaccctcagcactatacctgcagca
gcacctccttccagcaccggagttcggaaaagctggcacgaacacgtcactcaggacctg
cggagccatctagtgcataaacttgtccaagccatcttcccgacacctgaccctgcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatg
tacgagtctgccaacagcagggatgaatactatcacttactagcagagaaaatctacaag
attcaaaaagagctagaagaaaagcggaggtcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttatcagcccccgggacgcagccccctggaataccccaggcgcagcct
gtgagacctccaaatgggcccatgcctcttacagtgaatcgtatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaacgtacagttgccacaagcgcccatggga
ccgcgtgcggcatcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggctatttctccgtcccgaatgcctcagcctccgaacatgatgggcgcgcacgcc
aacagcatgatggcccaggcgcctgcgcagagccagttcctcccgcagagccagttcccg
tcgtccagcggggcgctgagtgtgagcagtgtgggcatggggcagccggcggcgcagact
ggcgttccacaggtactgtccatcgttttagttaatagctttttagttggcccacaggta
agtcgccttccccccccattcacacacccgccgctgcatcagaccccgcctcccgcctcc
acggccgccggcatgccgtctctgcagcacccagcagctcccggggtgacgcccccccag
ccagctgcgcctacccagccttcaactcccgcatcgtcttccgggcagactcccaccccg
actcctggctccgtgcccagcgccagccagacgcagagtactcctacggtccaggcagcc
gcccaggcccaggtgaccccgcagcctcagaccccagtgcagcctccatccgtggccacc
ccacagtcatcgcagcagcagccaacacctgtgcacacgcagccccccggcaccccgctt
tcccagacagcagccagcattgataacagggtccccactccatcctcagtggccagcgcc
gaaaccaactcccagcagccaggccccgaggtgccactgctggagatgaaggccgagatc
aagaccgaggacacagagcccgatgctggggagcccaagggagagcctggggctacgatg
atggaggaggacttacaaggatcttctcaagttaaagaagaaacagacccgacagagcag
aagtcagaaccaatggaagtggatgaaaagaaaactgaagtgaaggtcgaagctaaagag
gaagaagagggcagcaccaatgggacagcctctcagtccacgtccccttcgcagcctcgc
aagaaaatcttcaagccggaggagttgcgccaggctctgatgtcaaccctggaagctctg
taccgacaggatccagagtccttaccctttcggcagcctgtggatccccagctcctggga
attccagattactttgacattgtgaagaatcccatggacctttccaccatcaagcggaag
ctggatacagggcagtaccaggagccctggcagtatgtagacgacgtctggctcatgttc
aacaacgcctggctttacaatcggaagacatcccgggtctacaagttctgcagcaaactt
gcagaggtctttgagcaggagattgaccccgtcatgcagtcccttgggtattgctgtgga
cgcaagtatgagttttccccacagactctgtgctgctatgggaagcagctgtgtacaatt
cctcgagatgctgcctactacagctatcagaataggtatcacttctgtgagaagtgtttc
acagagatccagggggagaatgttaccctgggtgacgacccttcacaaccccagacgaca
atttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcctgaaccttttgtt
gactgcaaggagtgtggccggaagatgcatcagatttgtgttctccactacgacatcatc
tggccctcaggttttgtatgtgacaactgcttgaagaaaacgggcagaactcgaaaagaa
aacaaattcagtgctaagagactacagaccacacggttgggaaaccacctggaagaccga
gtcaacaagtttttgcggcgacagaatcaccctgaagctggggaggtgtttgtccgtgtg
gtggccagctcagacaagacagtggaggtcaagccagggatgaagtcacggttcgtggat
tctggggagatgtcggagtctttcccatacagaaccaaagcactctttgcctttgaggag
attgacggggtggacgtgtgcttctttgggatgcatgtccaggagtacggctctgactgc
cccccgccaaacacaaggcgtgtgtacatatcttatctggacagtattcatttcttccga
ccccgatgcctccgaacagccgtttaccatgagatccttattggatatttagagtatgtg
aagaaattggggtatgtgacagggcacatctgggcctgtcccccgagtgaaggagatgac
tacatcttccactgccacccccctgatcaaaaaatccccaagccgaagcgcctgcaagag
tggtataagaagatgctggacaaggccttcgccgagcgcatcatccatgactacaaggac
attttgaaacaagcaaatgaagacaggctcaccagcgccaaggagctgccctactttgag
ggggacttctggcctaacgtgctggaggagagcattaaggagctggagcaggaggaggaa
gagaggaagaaggaggagagcaccgcggccagcgagaccacagagggcagccagggcgac
agcaagaacgccaagaaaaagaacaataagaaaaccaacaagaataaaagcagcatcagc
cgcaccaacaagaagaagcccagcatgcccaacgtgtccaacgacctgtcccagaaactc
tacgccaccatggagaagcacaaagaggtcttctttgtgatccacctccatgctgggccc
gtcatccatacgctgccccccatcgtcgaccctgaccccctgctcagctgtgacctcatg
gacgggcgggatgccttccttacgctggcccgggacaagcactgggagttttcctccttg
cggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacccagggtcaggac
cgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgcacc
gtgtgcgaggactacgacctctgcatcaactgctacaacacaaagagccacacccacaag
tgccagtgccgcaacgccaacggctcactgccgtcctgccagaagatgaagcgggtggtg
cagcacaccaagggctgcaagcgcaagaccaacggcggctgcccggtgtgcaagcagctc
attgccctctgctgctaccacgccaaacactgccaagaaaacaagtgccccgtgcccttc
tgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcagcaggcc
cagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcagagcctg
ccttcccctacctcagcgccgccccagccgatgccgggcatgccccggcctgtgatgtcc
atgcaggcccagccggccgtggccgggccccggatgtccggtgtgcagccgccccggagc
atctcgcccggcgccctccaggacctgctgcggaccctgaagtcgcccagctccccgcag
cagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatggcagctttcatc
aaacagcgcacggccaagtacgtggccagccagcccggcctgcagccacagcctggcctc
caggcccagcccggcctgcaccagcagcccggcctgcagaacctgaacgccatgcaagcc
agcgggccgcggcctggcgtgcctccgcagcagcaggccatgggtggcctgaacccccag
ggccaagccctgaacatcatgaacccaggccacaaccccagcatggcgagtatgaacccg
cagtaccgagagatgctgaggaggcagctcctgcagcagcaacagcagcagcaacagcag
cagcagcagcagcagcagggcagcgccggcatggccgggggcatggcagggcacagccag
ttccagcagcccccaggccccgcgggctacccccctgccatgccgcagcagcggatgcag
cagcacctccccatgcagggcagcgccatgggcccgatggcggctcagatggggcagctc
ggccagatggggcagcccgggctgggcgcagacagcacccccaacatccagcaggccctg
cagcagcggattctgcagcagcagcagatgaagcagcagatggggtccccgggccagccg
aaccccatgagcccccagcagcacatgctctcaggacagcctcaggcctcgcacctcccc
ggccagcagatggccacatccctcagtagccaggtgcggtctccggcccctgtccagtct
ccgcggccccagtcccagcctccacattccagcccgtcgccacggatacagccccagcct
tcaccgcaccacgtctcgccccagactggttccccccacccaggactcgcagtcaccatg
gccagctccatagatcagggacacttggggaaccccgaacagagtgcaatgctcccgcag
ctgaacacccctaaccggagtgcgttgtccagtgagctgtccctggtcggcgacaccacg
ggagacaccctagaaaagtttgtggagggtttgtag

KEGG   Bos mutus (wild yak): 102273007
Entry
102273007         CDS       T02919                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04024  cAMP signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04310  Wnt signaling pathway
bom04330  Notch signaling pathway
bom04350  TGF-beta signaling pathway
bom04520  Adherens junction
bom04630  JAK-STAT signaling pathway
bom04720  Long-term potentiation
bom04916  Melanogenesis
bom04919  Thyroid hormone signaling pathway
bom04922  Glucagon signaling pathway
bom04935  Growth hormone synthesis, secretion and action
bom05016  Huntington disease
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05206  MicroRNAs in cancer
bom05211  Renal cell carcinoma
bom05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102273007 (EP300)
   04330 Notch signaling pathway
    102273007 (EP300)
   04350 TGF-beta signaling pathway
    102273007 (EP300)
   04630 JAK-STAT signaling pathway
    102273007 (EP300)
   04066 HIF-1 signaling pathway
    102273007 (EP300)
   04068 FoxO signaling pathway
    102273007 (EP300)
   04024 cAMP signaling pathway
    102273007 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102273007 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102273007 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102273007 (EP300)
   04935 Growth hormone synthesis, secretion and action
    102273007 (EP300)
   04919 Thyroid hormone signaling pathway
    102273007 (EP300)
   04916 Melanogenesis
    102273007 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    102273007 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102273007 (EP300)
   05206 MicroRNAs in cancer
    102273007 (EP300)
   05203 Viral carcinogenesis
    102273007 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102273007 (EP300)
   05215 Prostate cancer
    102273007 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102273007 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102273007 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102273007 (EP300)
   05161 Hepatitis B
    102273007 (EP300)
   05164 Influenza A
    102273007 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102273007 (EP300)
   05165 Human papillomavirus infection
    102273007 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102273007 (EP300)
   03036 Chromosome and associated proteins [BR:bom03036]
    102273007 (EP300)
   03029 Mitochondrial biogenesis [BR:bom03029]
    102273007 (EP300)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102273007 (EP300)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102273007 (EP300)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102273007 (EP300)
Mitochondrial biogenesis [BR:bom03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102273007 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102273007
NCBI-ProteinID: XP_005909489
LinkDB
Position
Un
AA seq 2408 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGVMSSPVSQPAMGMNTGMNAGMSPGMLT
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGSAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQMGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVAPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGSTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQPSNLLSDSMLHSAINS
QNPLMSDNGSVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMVPVMNTGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRVTPQPGLNQFGQMSM
PQPPIGPRQNSPLQHHVQLAQTGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTNM
PLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQVLHPPPRQTPTPPPTQLPPQVQPS
LPAAPSVDQAQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQTIPEKQPSQEVKMEPKMEVEAPEPADTQPEDIPETKAEDCKVEPTETEERGTELK
TETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMSTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPAPPTTPTG
QQPTTPQTPQPPPPSHPHPTPPNNMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPL
PGPPPAAVEVAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPGG
HLEPGMGPTGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVSQHGQPLNMPPQPGLGQVGV
SPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQ
PLPGQPGLQPPAMPGQQGVHSSPAMQNLNPMQAGVPRAGLPQQPTQQQQLPPPMGGMSPQ
AQQMNMNHSTMPSQFRDILRRQQMMQQQQQGAGPGMGPGLANHNQFQPPQGVGYPPRPPP
RMQHHMQQIPQGSMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHML
PSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSS
PHPGLVAAQGNPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLGTDNSDLNSNL
SQSTLDIH
NT seq 7227 nt   +upstreamnt  +downstreamnt
atggccgagaatgtcgtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacag
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaagcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcccaggcaggcttgacttctcccaacatggggatgggcact
agtgggccaaatcagggccccacgccgtctgcaacaggtgtgatgagcagtcccgtcagt
cagcctgccatgggaatgaacacggggatgaacgctggcatgagtcccggcatgctgact
gccggcaatggacaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgaccgaatatgcagtacccgaacccaggcatgggaagtgctggcaacttaatg
actgagccgctgcagcaaggctctccccagatggggggacagacgggactgagaggcccc
cagcctctcaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagatgggagccagtggccttggtctccagattccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaatatgggacagcagcaggccccacaggtccagcagccaggcctggtggctccggtg
gcccaggggatgggttctggggcacatacggctgatccggagaagcgcaagctcatccag
cagcagcttgtcctcctcctgcatgctcacaagtgccagcgccgggagcaggccaacggg
gaggtgaggcagtgcaaccttccccactgtcgaaccatgaagaacgtcctaaaccacatg
acacactgccagtcgggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcccactggaagaattgtacaaggcatgattgtcctgtgtgtctccccctgaaaaac
gctggagataagagaaatcaacagtcaattttgactggagcaccagttggacttggcagt
actagctctctaggggtgggtcaacagtccactcccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagagcctatgcagcccttggactgccctatcaagtaaatcag
atgccgacccagccccaggtgcaagcgaagaatcagcagaaccagcagtctgggcagtct
ccccaagggatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaccgtcgaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccactgatgagtgacaatggcagtgtggcctctctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaagcaatggcatgaagatattactcaggatctt
cgaaatcatcttgtccacaaactcgttcaagccatatttcccactccggatcctgctgct
ttaaaagacagacggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatcggcaaacaatcgagcggaatactaccacctgctagctgagaagatctataag
attcagaaggaactagaagaaaagcgaaggactagactacagaaacagaacatgctacca
agtgctgcaagcatggtgccagttatgaacacagggcctaacatggggcagccacaacca
ggaatgacttctaatggccctctccctgatccatctatgatccgtggcagtgtgccaaac
cagatgatgcctcgggtaactccacagcctggtttgaatcagtttggccagatgagtatg
cctcagccccctattggaccccggcaaaattctcctcttcagcaccatgtacagttagct
caaactggaacacttaacccgcctatgggctacgggcctcgcatgcagcagccttccagc
cagagccagtttcttcctcagactcaattctcaacacagggaatgaatgtaacaaatatg
cctttggctccgtctggcggtcaagcaccagtgtctcaagcacagatgtccagttcttcc
tgtcctgtgaactctcctataatgcctcctgggtctcaagggagccacattcactgtccc
cctctccctcaaccagctctgcatcagaactcaccctcacccgtacctagtcgcaccccc
acccctcaccacactccccctagcataggggctcagcagccaccagcaacagcaatccca
gcccctgttcctacgcctccagccatgccacctggcccacagtcccaggttctccatccg
cctccaagacagacgcctacgccgccaccaacacaacttcctccccaagtgcagccttcg
cttcctgctgctccctcagtcgaccaggcgcagcagcagcctctgtcccagcaaagcaca
gcagcctctgtgcccaccccgacggcacccctgctgcctccgcagccggcaactccactt
tcccagccagctgtaagcatcgaagggcaggtatcaaaccctccatccactagtagcaca
gaagtgaattctcagaccattcctgagaagcagccttcacaggaagtaaaaatggagcct
aaaatggaagtggaggcaccagaaccagcagatactcagccggaggatattccagagact
aaagcagaagactgtaaagtagaacctacagaaaccgaagagagaggcactgaattaaaa
actgagacaaaagaggaagaagaccagccaagtacttcagcgacccagtcatctccagcc
ccaggacagtcaaagaagaagattttcaaacctgaagagttacgacaggcactgatgtca
acactggaggcactttaccgacaggatccggaatcccttcccttccgtcagcctgtggac
cctcagcttctaggaatccctgattactttgatattgtgaagagccctatggatctttct
accatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggatgac
atttggctcatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtacaaa
tactgctccaagctgtctgaggtcttcgaacaagaaattgaccctgtcatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactctgttgctatggcaaa
cagttatgcacaatccctcgtgatgccacttactacagttatcagaacaggtatcatttc
tgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcc
caacctcaaactacaataaataaagaacaattttcaaagagaaaaaatgacactctggat
cctgaactgtttgttgagtgtacagagtgtgggagaaagatgcatcagatctgtgtcctc
catcacgagatcatctggccatcgggatttgtctgtgatggttgtttaaagaagactgca
cgaactagaaaagaaaataagttttctgctaaaagactgccatctaccaggcttgggaca
tttctggagaatcgtgtgaatgagtttctgaggcgacaaaatcaccctgagtcaggagag
gtcactgttcgagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatgaaa
gcaagatttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagcgctc
tttgccttcgaagagatcgatggtgttgacttgtgcttctttggtatgcacgttcaagag
tatggctctgactgccctccgcccaaccagaggagagtatacatatcatacctcgatagt
gttcacttcttccgtcctaaatgcttgaggactgcggtctatcatgaaatcctaattgga
tatttggaatatgtcaagaaattaggatacacaacagggcatatttgggcgtgtccgcca
agtgaaggagacgactacatcttccattgccacccccctgaccagaagatacccaagccc
aagcgactgcaggagtggtacaaaaagatgctcgacaaagctgtgtccgagcgaatcgtc
catgattataaggacattttaaaacaagctactgaagatcgattgacaagtgcgaaggaa
ttgccttactttgagggtgatttctggcccaacgtcctggaagagagcattaaggaactg
gaacaggaggaggaggagcggaagcgggaggagaacaccagcaacgagagcacagatgtg
acaaagggagacagcaaaaatgctaaaaagaaaaacaacaagaaaactagcaaaaacaag
agcagcctgagtcgtggcaataagaagaagccaggcatgcctaacgtatccaacgacctc
tcacagaaattgtatgccaccatggagaagcacaaagaggtcttctttgtgatccgtctc
atcgctggccctgccgccaactccctgcctcccattgttgaccccgaccccctcatcccc
tgtgacctgatggatgggcgggatgcctttctcacccttgcaagggacaagcacctggag
ttctcgtcgttgcgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacc
cagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacacgc
tggcactgcaccgtgtgtgaggattatgacttgtgtatcacctgctacaacactaaaaac
cacgaccacaagatggagaagctcgggctggggcttgatgacgagagcaacaaccagcag
gctgccgccacgcagagcccgggagactcccgccgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccc
atctgcaaacagctcatcgccctgtgctgctaccatgccaagcactgccaggagaacaag
tgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcagcac
cggctccagcaggcccagatgctgcgcaggaggatggccagcatgcagcggactggtgtg
gtggggcagcagcagggcctgccctcccctacccctgccccccctaccacgccgacgggc
cagcagcccaccaccccgcagacaccccagcccccccccccctctcacccccaccccaca
cctcccaacaacatgccgccctacttgcccaggactcaagctgctggcccagtgtcccag
ggcaaggcagcaggccaggtgacccccccgacccctcctcagactgctcagcccccactt
ccgggacccccacctgcagcagtggaggtggccatgcagattcagagggcagccgagacg
caacgccagatggcccacgtgcaaatctttcagcggccgatccagcaccagatgccgcag
atgactcccatggcccctatgggtatgaacccgccccccatggccagagggcctggtggg
catttggagccagggatggggcccactggcatgcagcagcaacccccatgggcccaggga
ggactgccccagccccagcagctgcagtccgggatgccccggccagccatgatgtcggtg
tcacagcacgggcagcccctgaacatgcctccccagccgggcctgggccaggtaggtgtg
agccctctcaagccaggcactgtgtctcaacaagccttacagaacctcctgcggactctc
aggtctcccagctcccccctgcagcagcaacaggtgctcagtatccttcatgccaacccc
cagctattggctgcgttcatcaaacagcgggctgccaagtacgccaactccaacccgcag
cccctccccgggcagccgggcctgcagccccccgctatgccaggtcagcagggggtccac
tccagccccgccatgcagaacttgaaccccatgcaggcaggtgtcccgagggctggcctg
ccccagcagcccacgcagcagcagcagctcccgccacccatgggcgggatgagcccacag
gctcagcagatgaacatgaatcacagcaccatgccctcgcaattccgagacatcttgagg
cgacagcagatgatgcagcagcagcagcagggagcggggccagggatgggcccggggctg
gccaaccacaaccagttccagcctccccagggcgtgggctaccctccccgcccgccaccg
cgaatgcagcatcacatgcagcagataccacaagggagcatgggacagatgggccagctc
ccgcaggccctgggagcagaggcgggagccagtctgcaggcctaccagcagcggctcctt
cagcaacagatgggctcgccggcccagcccaaccccatgagcccccagcagcacatgctc
ccgagtcaggctcagtccccgcacctccaaggccagcagatcccgtctctctccaatcaa
gtgcgatctccccagcctgtcccttctccgcggcctcagtcccagcccccccactccagc
ccttccccacggatgcagcctcagccttctccacaccacgtctccccacagaccagttct
ccacatcctggactggtcgctgcccagggcaaccccatggaacaagggcattttgccagc
ccggaccagaattcgatgctctctcagctcgctagcaatccaggcatggcaaacctccat
ggtgcgagcgccacggacctgggactcggcaccgacaactcagacttgaattcaaacctc
tcacagagtacactagacatacactag

DBGET integrated database retrieval system