KEGG   Bos mutus (wild yak): 102264981
Entry
102264981         CDS       T02919                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04915  Estrogen signaling pathway
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05223  Non-small cell lung cancer
bom05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102264981 (TGFA)
   04012 ErbB signaling pathway
    102264981 (TGFA)
   04014 Ras signaling pathway
    102264981 (TGFA)
   04151 PI3K-Akt signaling pathway
    102264981 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102264981 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102264981 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102264981 (TGFA)
   05212 Pancreatic cancer
    102264981 (TGFA)
   05225 Hepatocellular carcinoma
    102264981 (TGFA)
   05214 Glioma
    102264981 (TGFA)
   05211 Renal cell carcinoma
    102264981 (TGFA)
   05215 Prostate cancer
    102264981 (TGFA)
   05223 Non-small cell lung cancer
    102264981 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102264981 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 102264981
NCBI-ProteinID: XP_005904363
LinkDB
Position
Un
AA seq 160 aa
MVTSAGQLALFALGIFLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIVTCVL
IHCCEVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctcttcgcgctgggtattttcttggccgtgtgc
caggccctggagaacagcacatccgccctgagtgcagacccgcccgtggctgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggagaagccagcgtgtgtctgccactctgggtacgtcggtgca
cgctgtgaacacgcagacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtcctcatcgtcacatgtgtgctg
atacactgctgcgaggtccgaaaacactgtgagtggtgccgggcgctcatctgccggcat
gagaagcccagtgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system