KEGG   Bos mutus (wild yak): 102264992
Entry
102264992         CDS       T02919                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05214  Glioma
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102264992 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102264992 (CDK6)
   04115 p53 signaling pathway
    102264992 (CDK6)
   04218 Cellular senescence
    102264992 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102264992 (CDK6)
   05206 MicroRNAs in cancer
    102264992 (CDK6)
   05203 Viral carcinogenesis
    102264992 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102264992 (CDK6)
   05225 Hepatocellular carcinoma
    102264992 (CDK6)
   05214 Glioma
    102264992 (CDK6)
   05220 Chronic myeloid leukemia
    102264992 (CDK6)
   05218 Melanoma
    102264992 (CDK6)
   05224 Breast cancer
    102264992 (CDK6)
   05222 Small cell lung cancer
    102264992 (CDK6)
   05223 Non-small cell lung cancer
    102264992 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102264992 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102264992 (CDK6)
   05164 Influenza A
    102264992 (CDK6)
   05162 Measles
    102264992 (CDK6)
   05163 Human cytomegalovirus infection
    102264992 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102264992 (CDK6)
   05169 Epstein-Barr virus infection
    102264992 (CDK6)
   05165 Human papillomavirus infection
    102264992 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102264992 (CDK6)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102264992 (CDK6)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102264992 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 102264992
NCBI-ProteinID: XP_005906335
UniProt: L8I065
LinkDB
Position
Un
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERRKENLDSHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgtgccgaccagcagtatgagtgcgtggcggagatcggg
gagggcgcctacgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgagtgcagactggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gacgtgtgtacagtgtcacgaacagacagagaaaccaaactaacgttagtgtttgaacac
gttgatcaagacttgaccacttatttggataaagtgccagaacctggagtgcctactgaa
accataaaggatatgatgtttcagcttctccgaggcctggactttcttcattctcaccga
gtggtgcatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaag
ctggctgacttcggccttgctcgcatctacagttttcagatggctcttacctcagtggtc
gtcacgctgtggtaccgagctccggaagtcctgcttcagtccagctacgccacccctgtg
gatctctggagcgttggctgcatctttgcagagatgtttcgtagaaagccgctttttcgt
ggaagttcagatgtcgaccaactaggaaaaatcttggacgtaattggactcccgggagaa
gaggactggcctagagatgttgccctacccaggcaggcttttcactcaaaatcccctcaa
ccaattgagaagtttgtaacagacattgatgaacaaggcaaagacctgcttctgaagtgc
ttgacatttaatccagccaaaagaatatcagcatacagtgccctgtctcacccatacttc
cacgatctggagaggcgcaaggaaaacctggattcccacctgccgcccagccagaacagc
tcggaaatgaataccgcttaa

KEGG   Bos mutus (wild yak): 102278545
Entry
102278545         CDS       T02919                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04530  Tight junction
bom04660  T cell receptor signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05212  Pancreatic cancer
bom05214  Glioma
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102278545 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102278545 (CDK4)
   04115 p53 signaling pathway
    102278545 (CDK4)
   04218 Cellular senescence
    102278545 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102278545 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102278545 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102278545 (CDK4)
   05203 Viral carcinogenesis
    102278545 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102278545 (CDK4)
   05225 Hepatocellular carcinoma
    102278545 (CDK4)
   05214 Glioma
    102278545 (CDK4)
   05220 Chronic myeloid leukemia
    102278545 (CDK4)
   05218 Melanoma
    102278545 (CDK4)
   05219 Bladder cancer
    102278545 (CDK4)
   05224 Breast cancer
    102278545 (CDK4)
   05222 Small cell lung cancer
    102278545 (CDK4)
   05223 Non-small cell lung cancer
    102278545 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102278545 (CDK4)
   04934 Cushing syndrome
    102278545 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102278545 (CDK4)
   05160 Hepatitis C
    102278545 (CDK4)
   05164 Influenza A
    102278545 (CDK4)
   05162 Measles
    102278545 (CDK4)
   05163 Human cytomegalovirus infection
    102278545 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102278545 (CDK4)
   05169 Epstein-Barr virus infection
    102278545 (CDK4)
   05165 Human papillomavirus infection
    102278545 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102278545 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102278545 (CDK4)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102278545 (CDK4)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102278545 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 102278545
NCBI-ProteinID: XP_005901726
UniProt: A0A6B0RYR7
LinkDB
Position
Un
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG
DAE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctcccgatatgagccagtggctgagattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc
aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg
cggcgtctggaggcttttgagcatcccaatgttgtcaggcttatggacgtctgtgcaaca
gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagatctc
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccataaaagatctc
atgcgccaatttctaagaggcctggatttccttcatgccaactgcattgttcaccgagac
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat
cgtgctccagaagttcttttgcagtctacgtatgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgattggactgcccccagaggatgactggccccga
gatgtctctctaccccgaggagccttttccccccgagggccccgcccagtgcagtcggtg
gtccctgagctggaggaatctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt
gacgcagagtga

DBGET integrated database retrieval system