KEGG   Bos mutus (wild yak): 102265325
Entry
102265325         CDS       T02919                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04742  Taste transduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04961  Endocrine and other factor-regulated calcium reabsorption
bom04962  Vasopressin-regulated water reabsorption
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102265325 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102265325 (ADCY6)
   04371 Apelin signaling pathway
    102265325 (ADCY6)
   04072 Phospholipase D signaling pathway
    102265325 (ADCY6)
   04024 cAMP signaling pathway
    102265325 (ADCY6)
   04022 cGMP-PKG signaling pathway
    102265325 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102265325 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102265325 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102265325 (ADCY6)
   04062 Chemokine signaling pathway
    102265325 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    102265325 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    102265325 (ADCY6)
   04912 GnRH signaling pathway
    102265325 (ADCY6)
   04913 Ovarian steroidogenesis
    102265325 (ADCY6)
   04915 Estrogen signaling pathway
    102265325 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    102265325 (ADCY6)
   04921 Oxytocin signaling pathway
    102265325 (ADCY6)
   04926 Relaxin signaling pathway
    102265325 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    102265325 (ADCY6)
   04918 Thyroid hormone synthesis
    102265325 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    102265325 (ADCY6)
   04916 Melanogenesis
    102265325 (ADCY6)
   04924 Renin secretion
    102265325 (ADCY6)
   04925 Aldosterone synthesis and secretion
    102265325 (ADCY6)
   04927 Cortisol synthesis and secretion
    102265325 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102265325 (ADCY6)
   04270 Vascular smooth muscle contraction
    102265325 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    102265325 (ADCY6)
   04971 Gastric acid secretion
    102265325 (ADCY6)
   04972 Pancreatic secretion
    102265325 (ADCY6)
   04976 Bile secretion
    102265325 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102265325 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102265325 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    102265325 (ADCY6)
   04727 GABAergic synapse
    102265325 (ADCY6)
   04725 Cholinergic synapse
    102265325 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    102265325 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    102265325 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    102265325 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    102265325 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    102265325 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102265325 (ADCY6)
   04714 Thermogenesis
    102265325 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102265325 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    102265325 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102265325 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102265325 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102265325 (ADCY6)
   05163 Human cytomegalovirus infection
    102265325 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102265325 (ADCY6)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102265325 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 102265325
NCBI-ProteinID: XP_005896433
LinkDB
Position
Un
AA seq 1164 aa
MSWFSGLLVPKVDERKTAWGERNGQQRPRRGTRTSGFCTPRYMSCLQGAQPPXPATAPRC
PWQDEAFIRRGGPGKGPELGLRAVALGFEDPEVAGAVGAAEVAPAVATRSRRACWRQLVQ
VFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAALVLLTAVLLAFHAAPARPQPAYVALL
ACAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILVAVQVGGALAADPRSPSAGLWCPVF
FVYITYTLLPIRMRAAVFSGLGLSTLHLVLAWQLNRGDAFLWKQLGANMLLFLCTNVIGI
CTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKED
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIK
ILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGV
LGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKE
QHIETFLILGASQKRKEEKAMLAKLQRARANSMEGLMPRWVPDRAFSRTKDSKAFRQMGI
DDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRK
VDPRFGAYVACALLVFCFICFIQLVVFPRSALMLGIHASIFLLLLVTVLTCAVYSCGSLF
PEALQRVSRSIVRSRAHSTAVGIFSVLLVFTSAVASMFTCNHTPLRTCAARMLNLTPADI
TACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFIGNVLLSLLASSVFLHISSIGKLAMIFV
LGLVYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLV
FALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARE
RRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERF
RQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMK
IGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLE
CRGVVKVKGKGEMTTYFLNGGPRS
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgtcatggtttagcggcctcttggtccccaaggtggatgaacggaaaacagcctggggg
gagcgcaatgggcagcagcggccgcgccgtgggacccgcaccagtggcttctgcacgccc
cgctacatgagctgcctccagggtgcgcagccacccnnacccgccactgcccctcggtgc
ccctggcaggatgaggccttcatccggagggggggcccaggcaagggcccggagctgggg
ctgcgggcggtggccctgggcttcgaggaccctgaggtggccggggccgtcggagcagcg
gaggtggcgcctgccgtggccaccaggagcaggcgggcctgctggcgccagctggtgcag
gtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgctacttc
ttccagatgaaccagagcagcctgacgctgctcatggcggcgctcgtgctgctcacggcc
gtgctgctggccttccacgcagcgcctgcccgccctcagcccgcctacgtggccctgctg
gcctgtgccgccaccctcttcgtggcactcatggtggtgtgcaaccggcacagcttccgc
caggactccatgtgggtggtgagctacgtggtgctgggcatcctggtggccgtgcaggtc
gggggcgccttggcagccgacccgcgtagcccgtctgcaggcctctggtgccctgtgttc
tttgtctacatcacctacacactccttcccatccgcatgcgggctgcagtcttcagcggc
ctgggcctctccaccctgcacttggtcttggcctggcagctcaaccgtggtgacgccttc
ctctggaagcagcttggagccaacatgctgctgttcctctgcaccaatgtcattggcatc
tgcacacactatccggctgaggtgtctcagcgccaggcatttcaagagacccgcggttac
atccaggcccggctgcacctgcagcatgagaaccggcagcaggagcggctgctgctgtct
gtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaagaagac
atgatgtttcataagatctacatccagaagcacgacaatgtcagcatcctgtttgcggac
attgaaggcttcaccagcctggcatcccagtgcacagcgcaggagctggtcatgaccctg
aacgagctctttgcccggttcgacaagctggctgcggaaaatcactgcctgaggatcaag
atcttaggggactgttactactgcgtgtcagggctgccagaggcccgggcagaccatgcc
cactgctgcgtggagatgggggtggacatgatcgaggctatctcgctggtgcgcgaggtg
acaggtgtaaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcactgtggcgtc
cttggcttgcggaaatggcagtttgatgtgtggtccaatgacgtgactctggccaaccac
atggaggccgggggccgggccggccgcatccacatcacccgggccacgctgcagtacctg
aatggggactacgaagtggagccgggccgcggtggggagcgcaacgcctacctcaaggag
cagcacattgagaccttcctcatcctgggagccagccagaaacggaaagaagagaaggcc
atgctggccaagctgcagcgggcacgggccaactccatggaagggctgatgccacgctgg
gtgcctgaccgtgccttctcccggaccaaggactccaaggctttccgccagatgggcatc
gatgattccagcaaagacaaccggggtgctcaggatgccctgaaccctgaggatgaggta
gacgagttcctgggccgggccattgatgcccgcagcattgatcagctgcgcaaggaccat
gtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtactcacgcaag
gtggacccccgctttggagcctacgtggcctgtgccctgctggtcttctgcttcatctgc
ttcatccagcttgttgtcttcccacgctcagctctgatgcttgggatccacgccagtatc
ttcctgctgttactggtcaccgtgctgacttgtgccgtgtactcctgtggctctctgttc
cctgaggccctgcaacgtgtatctcgcagtatcgtccgctcgagggcacatagcaccgca
gttggcatcttttctgtcctgcttgtgttcacctccgccgttgccagcatgttcacctgt
aaccacacccccttacgaacttgcgcggcccggatgctgaatttaacccctgctgacatt
accgcctgccacctgcagcagctcaattactctctgggcctggatgctcccctgtgtgag
ggcaccgcacccacctgcagcttccctgagtacttcattgggaacgtgttgctgagtctc
ttggccagctctgtcttcctgcacatcagtagtatcgggaagttggccatgatctttgtc
ctggggctcgtttatctggtgctgcttctgctgggtcccccagccaccatctttgacaac
tatgacctcctgctgggcgtccatggcttggcttcttccaatgagacctttgatgggctg
gactgcccagcggccgggagggtggcactcaaatacatgacccccgtgattctgctggtg
tttgcactggcgctgtacctgcatgcccagcaggtggagtccaccgcccgcctggacttc
ctctggaagctgcaggcaacaggggagaaggaagagatggaggagctccaggcctacaac
cggcggctgctacataacattctgcccaaggacgtggccgcccacttcctggcccgggag
cgccggaacgacgagctgtactatcagtcctgtgaatgtgtggccgtcatgtttgcctcc
attgccaacttctctgagttctacgtggagctggaggccaacaacgagggtgttgagtgc
ctgcgactgctcaatgagatcattgctgatttcgatgagatcatcagtgaggagcgcttc
cggcagctggagaagatcaagacaattggtagcacctacatggctgcctctgggctgaac
gccagcacctatgatcaggtgggccgctcccacatcactgccctcgccgactatgccatg
cggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccagatgaag
atcggactgaacatgggcccagttgtggcaggcgtcattggggctcggaagccacagtat
gacatctgggggaacacagtgaatgtctcgagtcgaatggacagcaccggggtccccgac
cgaatccaggtgaccacggacctgtaccaggttctagcggccaagggctaccagctggaa
tgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctcaatggg
ggccccaggagttag

KEGG   Bos mutus (wild yak): 102266966
Entry
102266966         CDS       T02919                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102266966 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102266966 (ADCY7)
   04371 Apelin signaling pathway
    102266966 (ADCY7)
   04020 Calcium signaling pathway
    102266966 (ADCY7)
   04072 Phospholipase D signaling pathway
    102266966 (ADCY7)
   04024 cAMP signaling pathway
    102266966 (ADCY7)
   04022 cGMP-PKG signaling pathway
    102266966 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102266966 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102266966 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102266966 (ADCY7)
   04062 Chemokine signaling pathway
    102266966 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    102266966 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    102266966 (ADCY7)
   04912 GnRH signaling pathway
    102266966 (ADCY7)
   04913 Ovarian steroidogenesis
    102266966 (ADCY7)
   04915 Estrogen signaling pathway
    102266966 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    102266966 (ADCY7)
   04921 Oxytocin signaling pathway
    102266966 (ADCY7)
   04926 Relaxin signaling pathway
    102266966 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    102266966 (ADCY7)
   04918 Thyroid hormone synthesis
    102266966 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    102266966 (ADCY7)
   04916 Melanogenesis
    102266966 (ADCY7)
   04925 Aldosterone synthesis and secretion
    102266966 (ADCY7)
   04927 Cortisol synthesis and secretion
    102266966 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102266966 (ADCY7)
   04270 Vascular smooth muscle contraction
    102266966 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    102266966 (ADCY7)
   04971 Gastric acid secretion
    102266966 (ADCY7)
   04972 Pancreatic secretion
    102266966 (ADCY7)
   04976 Bile secretion
    102266966 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    102266966 (ADCY7)
   04727 GABAergic synapse
    102266966 (ADCY7)
   04725 Cholinergic synapse
    102266966 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    102266966 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102266966 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    102266966 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    102266966 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102266966 (ADCY7)
   04714 Thermogenesis
    102266966 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102266966 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    102266966 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102266966 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102266966 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102266966 (ADCY7)
   05163 Human cytomegalovirus infection
    102266966 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102266966 (ADCY7)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102266966 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 102266966
NCBI-ProteinID: XP_005902702
LinkDB
Position
Un
AA seq 1081 aa
MPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLMLLLVAIAACTTLIIITFSYGDPS
RHRAILGTAFFTLAVFVLLYALVYVECLDRRGLRISALLIWACLVTLGYVLVFDFDSPRK
DTCVLGQVPFFLFVVFVVYTLLPFSTWGAVTAGLVSSISHLLVLAMHQEDFTSPPAVAHL
QLLATAVVFVCGNLTGAFHKHHMQDASHDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLP
AHISMGMKLAIIERLKERGDRRYLPDNNFHNLYVKRHQNVSILYADIVGFTRLASDCSPK
ELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPNHARNCVKMGLDMCEAI
KQVREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITE
ATLKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPQPSQHNSKNKGDATLKM
RASVRMTRYLESWGAARPFAHLNQRESVSSSETLVSHGRRPKAVPLRRHRTPDRSVSPKG
RSEDDSYDDEMLSAIEGLSSTRPCCSKSDDFSTFGSIFLEKGFEREYRLAPIPRVRYYFA
CASLVFVCILLIHVLLLYSMKTLGVSFGLVACVLGLVLGLCFADVFLRCCPALGKLRAIA
ESVETQPLLRVSLAILTIGSLLVIAVVNLPLMPFRDRGLTAGNETGLRAVSGWEMSPCYL
LPYYTCSCILAFIACSVFLRMSLELKVVLLTVALVAYLVLFNVYPSWQWDCCGHSLGNLT
GTNGTLSSSSSCSWHLKTMTNFYLVLFYTTLIMLSRQIDYYCRLDCLWKKKFKKEHEEFE
TMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNK
EGLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVPSGPENQDLERQHA
HIGIMVEFSTALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVA
SRMESTGELGKIQVTEETCTILQGLGYSCECRGLIDVKGKGELRTYFVCTDTAKFQGLGL
N
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaacgagggcgaggagggccccgaccaggatgcg
ctctatgagaagtaccgcctcaccagccagcacgggccactcctgctcatgctcctgttg
gtggccatcgctgcctgcaccacgctcatcatcatcaccttcagctacggggacccctcc
agacaccgggccatcctggggacggcgttcttcacgctcgccgtgtttgtgctcctctac
gctctggtgtacgttgaatgcctcgaccggcgggggctcaggatttccgcgctgctcatc
tgggcctgccttgtgacgctgggctacgttttggtgtttgatttcgactcgccgaggaag
gacacctgtgtcttggggcaggtgcccttcttcctgttcgtggtcttcgtggtgtacacg
ctgctgcccttcagcacgtggggcgccgtcacggccggactcgtctccagcatctcccac
ctcctggtgctcgcaatgcaccaggaagacttcaccagccctcctgctgtggcccacctg
cagctgctggccactgcggtggtcttcgtgtgcgggaacctcacaggcgccttccacaag
caccacatgcaggacgcctcccacgacctcttcacctacacagtgaagtgcatccagatt
cggcgtaagctgcgcatcgagaagcgccagcaggagaacctgctgctgtctgtgctgcct
gcccacatctccatgggcatgaagctggccatcatcgagcggctcaaggagcgcggggac
cgccgttacctgcccgacaacaacttccacaacctctacgtcaagaggcaccagaatgtc
agcatcctctacgctgacatcgtgggcttcacgcgactggccagtgactgctcccccaaa
gagctggtggtggtgctgaatgagctcttcggcaagtttgaccagatcgccaaggccaat
gagtgcatgcggattaagatcctgggcgactgctactactgcgtgtccggcttgcctgtg
tccctgcccaaccacgcccgtaactgtgtgaagatggggctggacatgtgtgaggccatc
aagcaggtgcgggaggccacaggcgtggacatcagcatgcgcgtgggcatccactcggga
aacgtgctgtgcggcgtcatcgggctgcgcaagtggcagtacgacgtgtggtcccacgat
gtgtccctggccaacaggatggaggcggccggagtccctggccgggtgcacatcacagag
gcgacgctgaagcacctggacaaggcgtacgaggtggaggacgggcacgggcagcagcgg
gacccttacctcaaagagatgaacatccgcacctacctggtcatcgacccccggagccag
cagccgccccagcccagccagcacaactccaagaacaagggggacgcgaccctgaagatg
cgggcgtccgtgcgcatgacgcgctacctggagtcctggggggcggctcgccccttcgcg
cacctcaaccaacgcgagagcgtgagcagcagtgagacccttgtgtcccatgggcggagg
cccaaggctgttcccctgaggcgccatcggacccctgacagaagcgtatcccccaagggg
cggtcagaggacgactcatacgatgatgagatgctgtcagccatcgaggggctcagctct
accagaccctgctgctccaagtctgatgacttctctacctttgggtccatcttcctggag
aagggcttcgagcgagagtaccgcctggcgcccatcccccgggtccgctactacttcgct
tgtgccagcctcgtcttcgtctgcatcctgctcatccacgtcttgctgttgtacagtatg
aagactctgggtgtgtcctttgggctggtggcctgtgtgctcgggctggtactaggcttg
tgcttcgccgatgtgttcttgaggtgctgcccggccctggggaagctccgagccattgcc
gagagcgtggagacgcagcccctgctgcgggtgtccctggccatcctgaccatcggcagc
ctgctcgtcattgctgtcgtcaacctgcccctgatgcccttccgggaccgggggctgact
gctgggaacgagacaggcctgagggctgtgagcggctgggagatgagcccgtgctacctc
ctcccgtactacacctgcagctgcatcctggccttcatcgcttgctctgtcttcctgcgg
atgagcctggagctgaaggtcgtgctgctgaccgtggccttggtggcctacctggtcctc
ttcaacgtctacccgagctggcagtgggactgctgtggccacagcctgggcaacctcacc
gggaccaatggcaccctcagcagctcctcatcctgttcatggcatctgaagacgatgacc
aatttctacctggtcttgttctacaccaccctcatcatgctctccagacagattgactat
tattgccgcctggactgtctgtggaagaagaagttcaagaaggaacacgaggagtttgaa
acaatggagaatgtgaaccgccttcttctagagaatgtcctgcccgcgcacgtggctgcc
cacttcatcggtgacaagttaaatgaggactggtaccatcagtcctacgactgcgtgtgt
gtcatgtttgcgtcggtgccggactttaaagtcttctacacagagtgcgacgtcaacaag
gaagggctggagtgcctgcgcctgctcaacgagatcatcgccgactttgacgagctgctg
ctaaagcctaagttcagtggtgtggagaagatcaagaccatcggcagcacctacatggcc
gccgcggggctcagcgtcccctcggggcctgagaaccaggacctggagcggcagcacgcc
cacatcggcatcatggtggagttcagcaccgccctgatgagcaagctggacggcatcaat
cggcactccttcaactcctttcgcctccgagtcggcataaaccatgggcctgtgattgct
ggagtgattggggcacgaaaacctcagtacgacatctggggaaacacggtcaatgttgcc
agtcgaatggagagcactggagaacttggaaaaatccaggttactgaagagacatgtacc
atcctccagggactagggtattcctgtgagtgccgcgggctgattgacgtcaaaggcaaa
ggtgaactgaggacttactttgtctgtacggacaccgccaagttccaaggcctggggctg
aactga

KEGG   Bos mutus (wild yak): 102267116
Entry
102267116         CDS       T02919                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04720  Long-term potentiation
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05142  Chagas disease
bom05146  Amoebiasis
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102267116 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102267116 (ADCY1)
   04371 Apelin signaling pathway
    102267116 (ADCY1)
   04020 Calcium signaling pathway
    102267116 (ADCY1)
   04072 Phospholipase D signaling pathway
    102267116 (ADCY1)
   04024 cAMP signaling pathway
    102267116 (ADCY1)
   04022 cGMP-PKG signaling pathway
    102267116 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102267116 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102267116 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102267116 (ADCY1)
   04062 Chemokine signaling pathway
    102267116 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    102267116 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    102267116 (ADCY1)
   04912 GnRH signaling pathway
    102267116 (ADCY1)
   04913 Ovarian steroidogenesis
    102267116 (ADCY1)
   04915 Estrogen signaling pathway
    102267116 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    102267116 (ADCY1)
   04921 Oxytocin signaling pathway
    102267116 (ADCY1)
   04926 Relaxin signaling pathway
    102267116 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    102267116 (ADCY1)
   04918 Thyroid hormone synthesis
    102267116 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    102267116 (ADCY1)
   04916 Melanogenesis
    102267116 (ADCY1)
   04925 Aldosterone synthesis and secretion
    102267116 (ADCY1)
   04927 Cortisol synthesis and secretion
    102267116 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102267116 (ADCY1)
   04270 Vascular smooth muscle contraction
    102267116 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    102267116 (ADCY1)
   04971 Gastric acid secretion
    102267116 (ADCY1)
   04972 Pancreatic secretion
    102267116 (ADCY1)
   04976 Bile secretion
    102267116 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102267116 (ADCY1)
   04727 GABAergic synapse
    102267116 (ADCY1)
   04725 Cholinergic synapse
    102267116 (ADCY1)
   04720 Long-term potentiation
    102267116 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    102267116 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102267116 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    102267116 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    102267116 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102267116 (ADCY1)
   04714 Thermogenesis
    102267116 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267116 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    102267116 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102267116 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102267116 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102267116 (ADCY1)
   05163 Human cytomegalovirus infection
    102267116 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102267116 (ADCY1)
   05142 Chagas disease
    102267116 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102267116 (ADCY1)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102267116 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 102267116
NCBI-ProteinID: XP_005891937
LinkDB
Position
Un
AA seq 1024 aa
TNVRSLQVPQLQQVGQLALLFSLTFALLCCPFALGGHPGAHFFLAAVPATADQGVWQLLL
VTFVSYALLPVRSLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFLGVNVYG
VFVRILAERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPE
RIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIK
ILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGV
LGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSFLKT
HNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVM
TCEDDDKRRALRTASEKLRNRSSFSTNVVQTTPGTRVNRYIGRLLEARQMELEMADLNFF
TLKYKQAERERKYHQLQDEYFTSAVVLALILAALFGLVYLLIIPQSVAVLLLLVFCICFL
VACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWSWSSSPNGSLV
VLSSGGRDPVLPVPPCESAPHALLCGLVGTLPLAIFLRVSSLPKMILLAVLTTSYILVLE
LSGYTKAMGAGAISGRSFEPIVAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERDDME
KVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGN
NMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTKAKKCISSH
LSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVAS
RMDSTGVQGRIQVTEEVHRLLRRGSYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQTXX
XXXXXXXXXXGRAGLQTRLAAGHPPVPPAAGLPVGAGPGALQGSGLAPGPPGQHLPPGAS
GKEA
NT seq 3075 nt   +upstreamnt  +downstreamnt
accaacgtccgctcgctgcaggtgccccagctgcagcaggtcggccagctcgcgctgctc
ttcagcctcaccttcgctctgctgtgctgtccctttgctctcggcggccaccccggggcc
cacttttttttggcagcggtgccggcgacagccgatcagggagtctggcagctccttttg
gtcaccttcgtgtcctatgccctgctgcccgtgcgcagcctgctggccatcggcttcggg
ctcgtggtggccgcctcgcacttgctggtcacggctacgttggtccccgccaagcgccca
cgtctctggagaacgctgggtgccaacgctctgctcttcctcggtgtgaacgtgtatggc
gtcttcgtgaggatcctggctgagcgcgcccagaggaaggccttcctgcaggcccggaac
tgcattgaggaccggctgaggctggaggacgagaatgagaagcaggagcggctgctcatg
agcctcctgcctcggaatgttgccatggagatgaaggaggacttcctgaagccccctgag
aggattttccacaagatttacatccagcggcatgacaacgtgagcatcctctttgcagac
atcgtgggcttcacaggcttggcgtcacagtgcacggcccaggagctggtgaaactcctc
aacgagctcttcgggaagtttgacgagctggccacagagaaccactgccgccgcatcaag
atcctgggagattgctactactgcgtgtctggcctcactcagcccaagactgaccacgcc
cactgctgtgtggagatgggcctggacatgatcgacaccatcacgtccgtggctgaggcc
actgaggtggacttgaacatgcgtgtggggctgcacaccggcagggtcctctgcggggtc
ctgggcctgcgtaagtggcagtatgatgtgtggtccaacgacgtgaccctggccaacgtc
atggaggccgccggcctgcctgggaaggttcacatcacaaagaccaccctggcgtgcctg
aatggtgactatgaggtggagccgggacacggacacgagaggaacagttttctgaaaact
cataacattgagaccttttttattgtgccctcgcatcggcgaaagatatttccagggctg
attctctcagacataaaaccggccaagaggatgaagttcaagaccgtgtgctacctgctg
gtgcagctcatgcactgccggaagatgttcaaggccgagatccctttctccaacgtcatg
acctgtgaggacgacgacaagcggagggcactgagaacagcctcggaaaaactcagaaac
cgctcgtctttctctacaaacgttgtccaaaccacccccggcacacgtgtcaacaggtac
atcggccgcctcctggaagcccgccagatggagctggagatggcagacctgaacttcttc
accctgaagtacaagcaagctgagcgagagcgaaagtaccaccagcttcaggacgagtat
ttcaccagcgccgtggttctggctctcattctggccgccttattcggccttgtctacctt
ctaataatcccacagagtgtggctgtcctgctcctgctggtgttctgcatctgcttcctg
gtggcctgtgtcctgtacctacacatcacccgggtccagtgttttccagggtgcctgacc
atccagatccgcaccgtcttgtgcatcttcatcgtggtcttaatctactctgtggcccaa
ggctgtgtggtgggctgcctgccttggtcctggagctccagtcccaacgggtccctggtg
gtcctgtcttctgggggccgggacccagtgctgcctgtcccgccctgcgagtctgcgccc
cacgccctgctgtgcggcctcgtgggcaccctcccgctggccatattcctgcgggtctcc
tccttgccaaaaatgatcctgctcgccgtgctcaccacctcctacatcctcgtcctggag
ctcagcgggtacacgaaggccatgggggccggtgccatctcagggcgcagcttcgagccg
atcgtggccatcctgctgttctcatgcacgctggccctgcacgcccggcaggtggatgtc
aagctgcggctggactacctctgggcggcccaggcagaggaggagcgggatgacatggag
aaagtgaagctggacaacaagaggattctcttcaacctcctgccagcccacgttgcccag
cacttcctaatgtccaaccctcgcaacatggacctgtattaccagtcatactcgcaggtg
ggggtcatgtttgcatccatccccaacttcaatgacttctacatcgagctggatggcaac
aacatgggggtggaatgtctacgccttctgaatgagatcatcgctgactttgatgagctc
atggacaaagacttttacaaggacctagagaagatcaagaccattgggagcacgtacatg
gctgctgtggggctggcgcccactgctgggaccaaggctaagaagtgcatctcctcccac
ctcagcacgttggcagattttgccatcgagatgtttgatgtcctggatgagatcaactac
cagtcttataacgactttgtgctccgtgttggcatcaatgttggccccgtggtggctgga
gtgatcggggctcgcaggccgcagtatgacatttgggggaacacggtcaatgtggccagt
cggatggacagtactggcgtccagggcaggatccaggtcacagaggaagttcaccggctg
ctgcggcggggttcctaccgcttcgtgtgccgaggcaaagtcagtgtcaagggcaagggt
gagatgctgacatacttcctggaaggcaggaccgatggaaatggctcccaaacnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnncggaagagctggcctccagaccagactggct
gcgggtcaccccccggtacctcctgcagccggcctcccagttggagctgggccaggggct
ctgcagggctcggggcttgccccaggccccccaggccaacacctgccccctggagcctct
gggaaggaggcttag

KEGG   Bos mutus (wild yak): 102272964
Entry
102272964         CDS       T02919                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04720  Long-term potentiation
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04742  Taste transduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102272964 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102272964 (ADCY8)
   04371 Apelin signaling pathway
    102272964 (ADCY8)
   04020 Calcium signaling pathway
    102272964 (ADCY8)
   04072 Phospholipase D signaling pathway
    102272964 (ADCY8)
   04024 cAMP signaling pathway
    102272964 (ADCY8)
   04022 cGMP-PKG signaling pathway
    102272964 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102272964 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102272964 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102272964 (ADCY8)
   04062 Chemokine signaling pathway
    102272964 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    102272964 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    102272964 (ADCY8)
   04912 GnRH signaling pathway
    102272964 (ADCY8)
   04913 Ovarian steroidogenesis
    102272964 (ADCY8)
   04915 Estrogen signaling pathway
    102272964 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    102272964 (ADCY8)
   04921 Oxytocin signaling pathway
    102272964 (ADCY8)
   04926 Relaxin signaling pathway
    102272964 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    102272964 (ADCY8)
   04918 Thyroid hormone synthesis
    102272964 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    102272964 (ADCY8)
   04916 Melanogenesis
    102272964 (ADCY8)
   04925 Aldosterone synthesis and secretion
    102272964 (ADCY8)
   04927 Cortisol synthesis and secretion
    102272964 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102272964 (ADCY8)
   04270 Vascular smooth muscle contraction
    102272964 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    102272964 (ADCY8)
   04971 Gastric acid secretion
    102272964 (ADCY8)
   04972 Pancreatic secretion
    102272964 (ADCY8)
   04976 Bile secretion
    102272964 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    102272964 (ADCY8)
   04727 GABAergic synapse
    102272964 (ADCY8)
   04725 Cholinergic synapse
    102272964 (ADCY8)
   04720 Long-term potentiation
    102272964 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    102272964 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    102272964 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    102272964 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    102272964 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    102272964 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102272964 (ADCY8)
   04714 Thermogenesis
    102272964 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272964 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    102272964 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102272964 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102272964 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272964 (ADCY8)
   05163 Human cytomegalovirus infection
    102272964 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102272964 (ADCY8)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102272964 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N TBK1_ULD
Other DBs
NCBI-GeneID: 102272964
NCBI-ProteinID: XP_005900059
LinkDB
Position
Un
AA seq 1067 aa
MNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHTYLQY
SGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTSLMQV
VLQAVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLE
TENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFT
NLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVE
MGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG
IPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPEDIVKE
SVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGP
EEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFIVLL
FITAIQSLLPSSRVMPMAVQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWINETYLA
RNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTGVLAM
VTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTKEASLLL
MAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFL
EKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGE
DRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNN
FELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQG
FAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLN
RQRQKQLLNENNNTGIIKGHYNRRTLLTPSGPEPGAPAEGADKSELP
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgaacgtgctggacgtgctgaccaaactcaccctcctggttctccacttgagcctggcc
tcggcccccatggacccgctcaagggcatcctgctgggcttcttcaccggcatagaggtg
gtgatctgcgccctggtggtggtcagaaaggacaccacctcgcacacatacctgcagtac
agcggtgtggtcacttgggtggccatgaccacccagatcttagcagcagggctcggctat
gggctcctgggagacggcatcggctacgtgctcttcaccctttttgccacctacagcatg
ctgccgctgccgctcacctgggccatcctggccggcctaggcacctctttgatgcaggtg
gtcctccaagcggtcatccccaggctggcggtcatttccatcaatcaggttgtggcccag
gcagtgttattcatgtgtatgaacacagctggaatcttcatcagttacctgtcagaccgg
gcccagcgccaagccttcctggagacacggaggtgtgtggaggccaggctgcgcctggag
acggaaaaccaaagacaggagcgacttgtgctgtccgtgcttcctcgttttgttgtcctg
gagatgatcaatgacatgaccaacgtggaagacgagcacctacagcatcagttccaccgg
atctacatccatcgctacgagaatgtcagtattctttttgcagatgttaaaggatttacc
aacctctccacgaccttgtctgctcaggagctggtcaggatgctcaacgagctctttgcc
agatttgatcgactggcccatgagcatcactgccttcgtattaaaatcctgggggactgc
tactactgcgtttcaggacttcctgagccccgccaggaccacgcccactgctgtgttgaa
atgggcctcagcatgatcaaaactatcaggtatgtgcgatcaaggacaaagcacgatgtt
gacatgcggattggaatccactcgggctcggtgctgtgcggcgtgttgggtcttcggaag
tggcagtttgatgtctggtcttgggatgtggacatcgcgaacaaacttgaatctggagga
atccccgggcggattcacatttccaaagccacgctggactgcctcaacggtgactataat
gtggaagagggtcatggtaaagagaggaatgaattcttgaggaagcataatatagagacc
tatttaattaagcagcctgaggagagtctgctgtctttgcccgaagacatcgtcaaggag
tctgtgagctcctcagacaggagaaacagcggggcgacgttcacagagggatcttggagc
cctgaactgcccttcgataacatagtggggaaacagaacactctggctgccctaacaaga
aattcaataaatctacttccaaaccatcttgcacaagctttgcatgtccagtctgggcct
gaggaaattaacaagagaatagaacataccatcgacttgcggagtggtgataaattgaga
agagagcatatcaagccattctcactgatgtttaaagactccagcctggagcacaagtat
tctcaaatgagggatgaagtattcaaatcaaacttggtctgtgcgtttatcgttcttcta
tttatcacggcaatacaaagcttgcttccttcttcaagggtgatgcccatggccgtccag
ttttccatcctgatcatgctgcactcagctctggtcctcatcactacggcagaggattac
aagtgtttgcccctggtcctccggaaaacctgctgttggattaacgagacctatttggcc
aggaacgtcatcatctttgcatccatcttgattaatttcctgggcgccatcctaaatatc
ctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttcaattcctcagct
gtgtttacagatatctgctcctacccagagtactttgtcttcacgggggtgctggccatg
gtgacctgtgcggttttcctccgactcaactctgtccttaagctggctgtgctcctgatc
atgattgccatctacgccctgctgaccgagaccatctatgcaggcctcttcctgcgctat
gacaacctgaaccacagcggagaagatttcctggggaccaaggaagcgtcactgctgcta
atggccatgtttcttcttgccgttttctaccatggacagcagctggagtacacagcccgc
ctggacttcctgtggcgagtccaggccaaagaggagatcaacgagatgaaggagctgagg
gagcacaatgagaacatgctgcggaacatcctgcccagccacgtggcccgccacttcctg
gagaaggatcgggacaatgaggagctgtattctcaatcctatgacgccgtcggggtgatg
tttgcctccatcccggggtttgcagacttttactctcagaccgaaatgaacaaccaagga
gtggagtgcctccgcctactgaatgagatcattgctgacttcgatgagctgctcggtgaa
gaccggtttcaagacattgaaaagattaagaccattggtagtacctacatggccgtgtca
ggcctgtcacctgaaaagcagcaatgcgaggataagtgggggcatttgtgcgccctggcc
gacttctccctcgccctgactgaaagcatccaggagatcaacaagcattccttcaacaat
ttcgagctccggattggcatcagccacggctcagtggtagccggtgtcatcggcgctaag
aaaccacagtacgacatttggggcaaaaccgtgaacctggcgagtcggatggacagcaca
ggggtcagcggcaggatccaggtcccggaggagacctacctcatcctgaaggaccagggc
tttgcctttgactaccgaggggagatctatgtgaagggcatcagcgaacaggaagggaaa
atcaaaacgtactttctcctgggaagagtccagcccaaccccttcatcctgccccccagg
agactgcccgggcagtactccttggccgcagtcgtcctgggcctcgtccagtctctcaac
aggcagaggcagaagcagctgctgaacgagaacaacaacacgggcattatcaagggccac
tacaaccggcggactttgctgacacccagcgggcccgagccgggagccccagccgaaggc
gccgacaagtccgagttgccataa

KEGG   Bos mutus (wild yak): 102274117
Entry
102274117         CDS       T02919                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102274117 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102274117 (ADCY2)
   04371 Apelin signaling pathway
    102274117 (ADCY2)
   04020 Calcium signaling pathway
    102274117 (ADCY2)
   04072 Phospholipase D signaling pathway
    102274117 (ADCY2)
   04024 cAMP signaling pathway
    102274117 (ADCY2)
   04022 cGMP-PKG signaling pathway
    102274117 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102274117 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102274117 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102274117 (ADCY2)
   04062 Chemokine signaling pathway
    102274117 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    102274117 (ADCY2)
   04922 Glucagon signaling pathway
    102274117 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    102274117 (ADCY2)
   04912 GnRH signaling pathway
    102274117 (ADCY2)
   04913 Ovarian steroidogenesis
    102274117 (ADCY2)
   04915 Estrogen signaling pathway
    102274117 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    102274117 (ADCY2)
   04921 Oxytocin signaling pathway
    102274117 (ADCY2)
   04926 Relaxin signaling pathway
    102274117 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    102274117 (ADCY2)
   04918 Thyroid hormone synthesis
    102274117 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    102274117 (ADCY2)
   04916 Melanogenesis
    102274117 (ADCY2)
   04925 Aldosterone synthesis and secretion
    102274117 (ADCY2)
   04927 Cortisol synthesis and secretion
    102274117 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102274117 (ADCY2)
   04270 Vascular smooth muscle contraction
    102274117 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    102274117 (ADCY2)
   04971 Gastric acid secretion
    102274117 (ADCY2)
   04972 Pancreatic secretion
    102274117 (ADCY2)
   04976 Bile secretion
    102274117 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102274117 (ADCY2)
   04727 GABAergic synapse
    102274117 (ADCY2)
   04725 Cholinergic synapse
    102274117 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    102274117 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102274117 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    102274117 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    102274117 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102274117 (ADCY2)
   04714 Thermogenesis
    102274117 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274117 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    102274117 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102274117 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102274117 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102274117 (ADCY2)
   05163 Human cytomegalovirus infection
    102274117 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102274117 (ADCY2)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102274117 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 102274117
NCBI-ProteinID: XP_005905194
LinkDB
Position
Un
AA seq 913 aa
LPTWLQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYA
DIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNH
AKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLAN
HMEAGGVPGRVHISSVTLQHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQ
HLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHN
FQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKIIEKEYRA
TALPAFKYYVTCACLIFFCIFIVQVLVLPKTSILGISFGAAFLSLAFILFVCFAGQLLQC
SKKASASLLWLLKSSGIIANRPWPRISLTVITTAIILTMAVFNMFFLSDSEETILPTANA
SNTSLSGASNQAAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMAALVGYN
TIFLHTHAPLLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLVLGRQNEYYCRLDFLW
KNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEGQVNAGSSEGRTSCHAVG
IQSVLAVVLCILVIITIPQRVTSADVSRCQGNARTLLMVLGGVLPIMHCAHIGAWPFRLC
QAIQGPRGAGTSGKADPRPPRTSSRAHLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQE
HAQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQY
DIWGNTVNVASRMDSTGVLDKIQVTEETSVILQTLGYTCTCRGIINVKGKGDLKTYFVNT
EMSRSLSQSNLTS
NT seq 2742 nt   +upstreamnt  +downstreamnt
cttccaacctggcttcaggagcggctgctgctgtccctgctgccggcacacatagccatg
gagatgaaagcggagatcatccagaggctgcagggccccaaagccggccagatggagaac
accaacaacttccacaacctctacgtcaagcggcacaccaacgtcagtatcctctatgcg
gacattgttgggttcacccgtctggccagtgactgctcccctggagagctcgtccatatg
ctgaatgaactctttggaaagttcgatcaaattgcaaaggagaatgaatgcatgagaata
aaaattttaggagactgctactactgtgtgtccggactgcctatatctctccctaaccat
gccaagaattgtgtgaaaatgggactggatatgtgtgaagccataaagaaagtgagggac
gccaccggagtggacatcaacatgcgcgtgggagtgcattctgggaacgtgctgtgcggc
gtgatcgggctgcagaagtggcagtacgacgtgtggtcacatgacgtcaccctggccaac
cacatggaagctggaggggtccctggacgtgttcacatttcttctgttaccctgcaacac
ttgaatggagcttacaaagtggaagaaggcgatggtgacatcagagacccgtatttaaag
caacatttggtgaaaacttactttgtaatcaaccccaagggagagcggcggagccctcag
cacctctttaggcctcgacacacccttgacggagcgaagatgagggcttctgtccgcatg
acccggtacctggagtcctggggggcggccaagccctttgcacacctgcatcacagagac
agcatgactacggagaacggcaagatcagcaccacggatgtaccaatgggtcagcataat
tttcaaaatcgcaccttaagaaccaagtcacaaaagaaaagatttgaagaggaattaaat
gaaaggatgattcaagcaattgatggaatcaatgcacaaaagcaatggctcaagtccgaa
gacattcagagaatctcattgcttttctacaataaaataatagaaaaagaataccgagcc
accgcactgccggccttcaagtattacgtgacttgcgcttgcctgatcttcttctgcatc
tttatcgtgcaggttctggtcttacccaaaacgtccattctcggaatttcctttggagcg
gcgtttctctcacttgcctttatccttttcgtctgctttgctggacagcttttgcaatgc
agcaagaaagcatctgcttctctcctgtggcttttaaagtcatcgggcatcatcgccaac
cggccctggcctcggatctccctgacggtcatcaccacggccatcatattgaccatggcc
gtgttcaatatgtttttcctgagtgactcagaggaaacaattcttccgactgccaacgcg
tccaacacaagtctttctggcgcaagtaaccaggcagcaattctgcgtgcgcaaaatttg
tttttcctgccgtactttatatacagctgcatccttgggctgatctcctgttccgtcttc
ctgcgtgtgaattacgagctgaagatgctgatcatgatggcagccttggtgggctacaac
accatcttcctccacactcacgctcccctcctggacgactacagccaggtcctgttcgag
agaccaggcatttggaaagacctaaagaccatgggctcagtatctctctttatatttttc
atcacactgcttgttctgggaagacagaatgaatattactgtaggttagacttcttatgg
aagaacaagttcaaaaaagagcgggaggagatagaaaccatggagaacttgaaccgagtg
ctgctggagaacgtgcttcctgcgcacgtggctgagcacttcctggcgcggagcctgaag
aacgaggggcaagttaatgctggtagttcagaggggcgcacatcctgccacgcagtgggc
attcagtcagtgctggcggttgtcctgtgcattcttgtcatcatcaccattccccagagg
gtcacttcggctgatgtcagcagatgccagggaaacgcaagaactctcctcatggttctt
ggtggagtgcttcccatcatgcactgcgcccacattggcgcctggccattccgcctgtgt
caggccatccaagggccccgaggagccggcaccagtggaaaagcagatccccggcccccc
aggaccagctcccgcgcccacctgctctccaagccgaagttcagtggtgttgaaaagatc
aagaccatcggcagcacgtacatggcagcgacaggtctgagcgcggtgcccagccaggag
cacgcccaggagccggagaggcagtacatgcacattggcaccatggtggagtttgcattt
gccctggtggggaagctggatgccatcaacaagcactccttcaatgacttcaagttacga
gtaggtattaaccatggccctgtcatagccggtgtgattggagctcagaagccgcagtat
gacatctggggcaacaccgtcaatgtggccagcaggatggacagcaccggagtcctggac
aaaatccaggtgacagaggagacgagcgtcatcctacagaccctaggctacacgtgcacg
tgtcggggaatcatcaacgtgaaaggaaagggggacctgaagacctacttcgtcaacacg
gagatgtcacggtccctttctcagagcaacctgacctcctga

KEGG   Bos mutus (wild yak): 102276460
Entry
102276460         CDS       T02919                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04726  Serotonergic synapse
bom04727  GABAergic synapse
bom04728  Dopaminergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04924  Renin secretion
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05012  Parkinson disease
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05032  Morphine addiction
bom05034  Alcoholism
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102276460 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102276460 (ADCY5)
   04371 Apelin signaling pathway
    102276460 (ADCY5)
   04072 Phospholipase D signaling pathway
    102276460 (ADCY5)
   04024 cAMP signaling pathway
    102276460 (ADCY5)
   04022 cGMP-PKG signaling pathway
    102276460 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102276460 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102276460 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102276460 (ADCY5)
   04062 Chemokine signaling pathway
    102276460 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    102276460 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    102276460 (ADCY5)
   04912 GnRH signaling pathway
    102276460 (ADCY5)
   04913 Ovarian steroidogenesis
    102276460 (ADCY5)
   04915 Estrogen signaling pathway
    102276460 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    102276460 (ADCY5)
   04921 Oxytocin signaling pathway
    102276460 (ADCY5)
   04926 Relaxin signaling pathway
    102276460 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    102276460 (ADCY5)
   04918 Thyroid hormone synthesis
    102276460 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    102276460 (ADCY5)
   04916 Melanogenesis
    102276460 (ADCY5)
   04924 Renin secretion
    102276460 (ADCY5)
   04925 Aldosterone synthesis and secretion
    102276460 (ADCY5)
   04927 Cortisol synthesis and secretion
    102276460 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102276460 (ADCY5)
   04270 Vascular smooth muscle contraction
    102276460 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    102276460 (ADCY5)
   04971 Gastric acid secretion
    102276460 (ADCY5)
   04972 Pancreatic secretion
    102276460 (ADCY5)
   04976 Bile secretion
    102276460 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    102276460 (ADCY5)
   04727 GABAergic synapse
    102276460 (ADCY5)
   04725 Cholinergic synapse
    102276460 (ADCY5)
   04728 Dopaminergic synapse
    102276460 (ADCY5)
   04726 Serotonergic synapse
    102276460 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    102276460 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102276460 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    102276460 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    102276460 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102276460 (ADCY5)
   04714 Thermogenesis
    102276460 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102276460 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102276460 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    102276460 (ADCY5)
   05031 Amphetamine addiction
    102276460 (ADCY5)
   05032 Morphine addiction
    102276460 (ADCY5)
   05034 Alcoholism
    102276460 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102276460 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102276460 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102276460 (ADCY5)
   05163 Human cytomegalovirus infection
    102276460 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102276460 (ADCY5)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102276460 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA DUF2339 TBK1_ULD PEN-2
Other DBs
NCBI-GeneID: 102276460
NCBI-ProteinID: XP_005893490
LinkDB
Position
Un
AA seq 1082 aa
VEEDEGSGDGGSSAGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKSRVFSSAPKDXXDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQTLSRKIVRSKMNSTLVGV
FTITLVFLSAFVNMFTCNSKDLFGCLGDEHNISASQVNACHVVESAVNYSLGDEQGFCGS
SWPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPGVTLFDNAD
LLVTANAIDFSNNGTSQCPEHPTKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
PS
NT seq 3249 nt   +upstreamnt  +downstreamnt
gtcgaggaagacgaagggtccggggatgggggcagctcggcaggctcgggcgcggggcct
ggcgcggtgctgtcgctgggcgcctgctgcctggcactgctgcagatattccgctctaag
aagttcccatcggacaagctggagcggctgtaccagcgctacttcttccgtctgaaccag
agcagcctcacaatgctcatggctgtgctggtgctcgtgtgcctagtcatgttggccttc
cacgcggcacggcccccgctgcagctgccctacctggccgtcctagcggccgccgtgggt
gtgatcctcgttatggccgtgctctgcaaccgcgccgccttccaccaggaccacatgggc
ctggcctgctacgcgcttatcgccgtggtgctggccgtccaggtggtgggcctgttgctg
ccccagccgcgcagtgcctccgagggcatctggtggactgtgtttttcatctatacgatc
tacacgctcctgcccgtgcgcatgcgggctgcggtactcagcggggtgctcctgtccgcc
ctccacctggccatcgccctgcgcaccaacgcccaggatcagttcctgctcaagcagctc
gtctccaacgtcctcattttctcctgcaccaacattgtgggtgtgtgcacccactacccg
gctgaggtctcgcagaggcaggccttccaggagacccgggagtgcatccaggcacggctc
cactcacagcgggagaaccagcagcaggagcggctcctgctgtctgtccttccccgtcac
gttgccatggagatgaaagccgacatcaacgccaaacaggaggatatgatgttccataag
atttacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggtttcacc
agcctggcatcccagtgcactgcccaggagctggtcatgaccctcaacgagctcttcgcc
cgcttcgacaagctggctgcggagaatcactgtttacgtattaagatcctgggagattgt
tattactgtgtctcagggctgcctgaagccagggctgaccacgcccactgctgcgtggag
atgggcatggacatgatcgaggccatctcgctggtccgggaggtgacaggtgtgaacgtg
aacatgcgtgtgggaattcacagcgggagagtgcactgcggtgtcctcggcctcaggaag
tggcagttcgatgtctggtctaacgatgtcacactggccaaccacatggaggctggaggc
aaggcgggacgcatccacatcaccaaggccactctcaactacttgaatggtgactacgaa
gtggagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagacc
tttctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgattgccaagatg
aaccgtcagagaaccaactccatcgggcacaacccgccccactggggggccgagcgcccc
ttctataaccacctggggggcaaccaggtgtccaaggagatgaagcggatgggctttgaa
gaccccaaggacaaaagtagagtgtttagttcagcaccaaaagatnnnnnggatgaattt
ctgggccgtgccattgatgccaggagcatcgacaggctgcgatctgaacatgttcgcaag
ttcctcttgaccttcagggagcctgacttagagaagaagtactccaagcaggtggatgac
cgatttggtgcctacgtggcctgtgcctcgctcgtcttcctcttcatctgctttgtccag
atcaccattgtgccccactccgtgttcatgttgagtttctacctgacctgtttcctgctg
ctgaccttggtggtgtttgtgtccgtgatctattcttgcgtgaagctcttcccagccccg
ctgcagacgctctccaggaagatcgtgcggtccaagatgaacagcaccctggtgggggtg
ttcaccatcaccctcgtgttcctgtcggctttcgtcaacatgttcacgtgcaactccaag
gacctgtttggctgcctgggggacgagcacaacatcagtgccagtcaggtcaatgcatgc
cacgtggtggagtcggccgtcaactacagtctgggtgacgagcagggcttctgcggcagc
tcctggcccaactgcaacttccccgagtacttcacctatagcgtgctgctcagcctgctg
gcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatc
gagctcatctacgtgctcgtcgttgaggtgcccggtgtcacgctctttgacaatgccgac
ctactggtcacggccaacgccatagacttcagcaacaacgggacctcccagtgccctgag
catccaaccaaggtggcgctgaaggtggtgacgcccatcatcatctccgtcttcgtgctg
gccctgtacctgcatgcccagcaggtggagtccactgcccgcctcgacttcctctggaaa
cttcaggccacggaggagaaggaggagatggaggagctgcaggcctacaaccggcggctg
ctgcacaacattctgcccaaggacgtggccgcacacttcctggcccgcgaacggcgcaac
gacgagctctactatcagtcgtgcgagtgcgtggccgtcatgttcgcctccatcgccaac
ttctctgagttctatgtggaactagaggccaacaacgagggcgtcgagtgcctgcggcta
ctcaacgagatcatcgcagactttgacgagatcattagtgaggaccggttcaggcagctg
gaaaagatcaagaccatcggcagcacctacatggccgcctccggcctcaatgactccacc
tacgacaaggtgggcaagacccacatcaaagccctggccgacttcgccatgaagttgatg
gaccaaatgaagtacatcaacgagcactctttcaacaacttccagatgaagatcgggctc
aatattggccccgtggtggcgggtgtgattggagcccgcaagcctcagtacgacatctgg
ggcaatacggtgaacgtggccagccgcatggacagcaccggtgtgcccgaccgcatccag
gtcaccacagacatgtaccaggtgctggccgccaatacgtaccagctggagtgccggggt
gtggtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaacggaggacccccg
cccagttag

KEGG   Bos mutus (wild yak): 102282732
Entry
102282732         CDS       T02919                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04740  Olfactory transduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04962  Vasopressin-regulated water reabsorption
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102282732 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102282732 (ADCY3)
   04371 Apelin signaling pathway
    102282732 (ADCY3)
   04020 Calcium signaling pathway
    102282732 (ADCY3)
   04072 Phospholipase D signaling pathway
    102282732 (ADCY3)
   04024 cAMP signaling pathway
    102282732 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102282732 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102282732 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102282732 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102282732 (ADCY3)
   04062 Chemokine signaling pathway
    102282732 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102282732 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102282732 (ADCY3)
   04912 GnRH signaling pathway
    102282732 (ADCY3)
   04913 Ovarian steroidogenesis
    102282732 (ADCY3)
   04915 Estrogen signaling pathway
    102282732 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102282732 (ADCY3)
   04921 Oxytocin signaling pathway
    102282732 (ADCY3)
   04926 Relaxin signaling pathway
    102282732 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102282732 (ADCY3)
   04918 Thyroid hormone synthesis
    102282732 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102282732 (ADCY3)
   04916 Melanogenesis
    102282732 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102282732 (ADCY3)
   04927 Cortisol synthesis and secretion
    102282732 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102282732 (ADCY3)
   04270 Vascular smooth muscle contraction
    102282732 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102282732 (ADCY3)
   04971 Gastric acid secretion
    102282732 (ADCY3)
   04972 Pancreatic secretion
    102282732 (ADCY3)
   04976 Bile secretion
    102282732 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102282732 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102282732 (ADCY3)
   04727 GABAergic synapse
    102282732 (ADCY3)
   04725 Cholinergic synapse
    102282732 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102282732 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102282732 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102282732 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102282732 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102282732 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102282732 (ADCY3)
   04714 Thermogenesis
    102282732 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282732 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102282732 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102282732 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102282732 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102282732 (ADCY3)
   05163 Human cytomegalovirus infection
    102282732 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102282732 (ADCY3)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102282732 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 102282732
NCBI-ProteinID: XP_005895740
LinkDB
Position
Un
AA seq 1145 aa
MPRTQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSGDKLAPLAVAGVGLVLDII
LFVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGVQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGLNGSVTPNGAPPSSKPSSPALIETKESNGSIHT
SGSISEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWCPIFDDYDRKRFQQHDFPMVALEKMQVFSSSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKDEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgagcccgagtactccgcggagtactcggccgagtac
tctgtcagcctgccttcggaccctgaccgcggggtgggccggacccatgaaatctctgtc
cggaactcggggtcgtgcctctgcttgcctcgcttcatgcggctgaccttcgtaccagag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcggccctcttcgactgctatgtggtggtcatgtgcgctgtggtcttc
tctggcgacaagctggcccccctggccgtggctggggtcgggctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaggtcttctcctacctgggcctgaacttctcc
cgtgcccacgcggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgtcgtg
cacacactcgtcttaggggtcactgtggcccagcagcagcaggatgggctgaagggagtg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagtcagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgctgatatcgtgggcttcacccagctgtcctcagcctgcagcgcccaggagctt
gtgaagctgctcaatgagctctttgcccgcttcgacaagctggcggctaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagaccggggtggacatgcgcgtgggggtgcacacgggcaccgtg
ctggggggcgtcctcggccagaaacgctggcagtacgacgtgtggtccaccgacgttacc
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagttcgacgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcatcgagacctacctcatcatcgcgtccaagccagaggtgaag
aagacagctgcccaaaacggcctcaacggctcggtgaccccaaacggggcgccgccttcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagcattcacacc
agcggctctatatctgaggagcccgaggagcaagatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggctgatcgcgtggtggacgcctcc
gaggacgagcatgagctcaaccagctactcaacgaggcgctgctagagcgggagtctgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagcggggctgccttcagctgctcctgc
gttgtcctgctctgcacggccgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatcctgacaatctgctcgctggct
gccatctttccgcgggcctttcctaagaagctcgtggccttctctacttggattgaccgg
acgcgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggacccaccaacggcaccgcagag
atgcaggtggaggatggctgtgtggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgcgggggccgtggctgtcatcaacatctacgcctggtgccccatctttgac
gactacgaccgcaaacgcttccagcaacacgactttccgatggtggccttagagaagatg
caggtgttttccagctcggggctcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatcttcgtcatgatgctgagcttttactacttctcccgccac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaagccttggtcaccaacatgctgcctgaacac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctacgcttcctcaatgagatcatctcagatttt
gactctcttctggacaatcccaagttccgggtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggacgagaagtcagacaaggagcgctggcagcacctggcagatctggccgatttt
gcgctggccatgaaggacacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgtagccagcaggatggagtccacaggggtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagaatacggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacattccctaacggcgcctcaatcacactgcctcaccag
gtggtagacaactcctga

KEGG   Bos mutus (wild yak): 102285642
Entry
102285642         CDS       T02919                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04961  Endocrine and other factor-regulated calcium reabsorption
bom04962  Vasopressin-regulated water reabsorption
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102285642 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102285642 (ADCY9)
   04371 Apelin signaling pathway
    102285642 (ADCY9)
   04020 Calcium signaling pathway
    102285642 (ADCY9)
   04072 Phospholipase D signaling pathway
    102285642 (ADCY9)
   04024 cAMP signaling pathway
    102285642 (ADCY9)
   04022 cGMP-PKG signaling pathway
    102285642 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102285642 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102285642 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102285642 (ADCY9)
   04062 Chemokine signaling pathway
    102285642 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    102285642 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    102285642 (ADCY9)
   04912 GnRH signaling pathway
    102285642 (ADCY9)
   04913 Ovarian steroidogenesis
    102285642 (ADCY9)
   04915 Estrogen signaling pathway
    102285642 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    102285642 (ADCY9)
   04921 Oxytocin signaling pathway
    102285642 (ADCY9)
   04926 Relaxin signaling pathway
    102285642 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    102285642 (ADCY9)
   04918 Thyroid hormone synthesis
    102285642 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    102285642 (ADCY9)
   04916 Melanogenesis
    102285642 (ADCY9)
   04925 Aldosterone synthesis and secretion
    102285642 (ADCY9)
   04927 Cortisol synthesis and secretion
    102285642 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102285642 (ADCY9)
   04270 Vascular smooth muscle contraction
    102285642 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    102285642 (ADCY9)
   04971 Gastric acid secretion
    102285642 (ADCY9)
   04972 Pancreatic secretion
    102285642 (ADCY9)
   04976 Bile secretion
    102285642 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102285642 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102285642 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    102285642 (ADCY9)
   04727 GABAergic synapse
    102285642 (ADCY9)
   04725 Cholinergic synapse
    102285642 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    102285642 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102285642 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    102285642 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    102285642 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102285642 (ADCY9)
   04714 Thermogenesis
    102285642 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102285642 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    102285642 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102285642 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102285642 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102285642 (ADCY9)
   05163 Human cytomegalovirus infection
    102285642 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102285642 (ADCY9)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102285642 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053
Other DBs
NCBI-GeneID: 102285642
NCBI-ProteinID: XP_005901380
UniProt: L8IB07
LinkDB
Position
Un
AA seq 1354 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVRINPKQPSSNSHPKHCKYSISSSCSSSGDS
GGVPRRMGAGGRLRRRKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMKSKLIVMVAPALCFLVVCVGFFLFTFTKLYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDNFNHTRAARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLILGVAYSVLFETFGYHFQDEACFASPGAEALHWELLSRALLHLCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQSVVADQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVLDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFTPKPEAGAEGGAVQNGCQEEPKN
SAKASGGPSSKTQNGLLSPPPEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDPELERAYRTSYQEEVVKSSPVRTF
ASATFSSLLDVLLSTTVFLILSITCFLRYGAASTPPPPAALAVFGAALLLEILSLVVSVR
MVFFLEDVMTCTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHSTMFTGS
AVLTAVVQYCNFCQLSSWMRSSLATVVGAGPLLLLLYISLCPDSSTVISHLDAVQNFSST
RKLCNASLSHDGRSPASLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRT
KIQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGK
ECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATQCRDGSHPQEHLQILF
EFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDT
TGVECRIQVSEESYRVLSKMGYEFDYRGTVNVKGKGQMKTYLYPKCTDSGLVPQHQLSIS
PDIRVQVDGSIGRSPTDEIASLVPSVQNPDQVSPGSENNAQTRDAHPSAKRPWKEPVRAE
ERCRFGKAIEKSDCEEVGMEEANELTKLNVSERA
NT seq 4065 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcaccgaggtgagctgtgac
tccagcggagacagcaacagcgtgcgggtcaggatcaaccccaagcagccgtcctccaac
agccacccgaagcactgcaagtacagcatctcctccagctgcagcagctccggggactcc
ggaggggtcccccgaagaatgggcgcgggaggccgcctgcgcaggaggaagaagctgccc
cagctgttcgaacgggcctccagccggtggtgggaccccaagtttgactctgtgaacctg
gaggaggcttgcatggagcgttgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgccttctctggagcatctattttggggtccacatgaaatcg
aaactgattgtcatggtagcccctgctctgtgcttcctcgtggtgtgtgtgggctttttt
ctgtttaccttcaccaagttgtacgcccgccattacgtgtggacttcgctggttctcacc
ctcctggtattcgccctgaccctggctgcccagtttcaggttttgacgcccctctcagga
cgagttgacaacttcaatcatactcgggctgccaggcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgattttgggagtggcctattctgttctttttgagacctttggc
taccacttccaagatgaagcctgctttgcctcacctggagcggaggctctgcactgggag
ctgctgagccgggccctgctccacctctgcatccacgccatcgggatccacctgttcatc
atgtcccaggtgagatccaggagcaccttcctcaaggtgggccagtctattatgcacgga
aaggatctggaagtggaaaaggccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaaacagggggatgaggagagtgagaattctgtcaaaagg
cacgccacctccagccccaagaacaggaagaagaagtcttccatccagaaagcccctatc
gccttccgcccgtttaagatgcagcagatcgaagaagtcagtattttatttgcagatatt
gtgggcttcaccaagatgagtgccaataagtctgcccacgccctggtgggtctcctcaac
gatctgttcggccgctttgaccggttgtgtgaggagaccaaatgtgagaaaatcagcacc
ttgggagactgctactattgtgtggctgggtgtcctgagccaagggccgaccatgcctac
tgctgcatcgagatggggttgggcatgataagagccattgaacagttctgccaagagaag
aaagagatggtgaacatgcgcgttggggttcacacagggaccgtcctgtgtggcatcttg
ggcatgaggaggtttaaatttgatgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttccgaggccaccgcaaaatacctagat
gaccggtacgaaatggaggatgggaaagttactgaacgccttggccagagtgttgttgct
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcac
tgcagctgttcagaggccttactttctggctttgaggtccttgacggctcgcgggtgtcc
tcaggccctaggggacaggggacagcgtcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccatcgtgcggaatcacgttcactcccaag
ccagaagctggtgcagaaggtggagcggtccagaacggctgtcaggaggagcccaagaac
agcgccaaggcctccggaggacccagctccaaaacgcaaaatggacttctgagtcctccc
ccggaggagaagctcaccaacagtcagacctccctgtgcgagatcttacaggagaagggc
aggtgggcaggcgtgagcctggatcagtcggctctccttccgctgaggttcaagaacatc
cgggagaaaacggatgcccactttgtcgacgttatcaaggaagacagcctgatgaaagac
tacttttttaagccgcccattaaccagttcagcttgaacttcctggatccggagctcgag
cgggcctacaggaccagctatcaagaagaggttgtaaagagctctcccgtgaggactttc
gccagtgccaccttcagctccctcctggatgtgcttctgtcgacaacagtgtttctgatt
ctctccatcacctgcttcctgaggtacggggccgcctccacgccgcccccgccggccgcc
ctggcagtcttcggagcggccctgctgctggagatcctgtccctcgtggtctctgtcagg
atggtgttcttcctggaggacgtgatgacgtgcacgaagcgcctgctggagtggatagcc
ggctggctcccgcgccatttcatcggggccatcctggtgtctctccccgccctggcagtg
tattcacacgtcacctctgaatttgaaacaaacatacactccaccatgttcacgggctcg
gccgtgctgaccgccgtggtgcaatactgcaacttctgccagctcagctcctggatgcgg
tcctccctggccactgtcgtcggggccgggcccctgctgctgctgctctacatctccctg
tgcccggacagttccactgtaatttcacaccttgatgcagtacagaatttcagctccacc
aggaagctgtgcaacgcctcgctgtctcacgacggcaggagcccagccagcctgatcggc
caggaggtgattctcgtcttcttcctcctgctcctgttggtctggttcctgaaccgagag
ttcgaagtcagctaccgcctgcactaccacggggacgtggaggcggacctgcaccgcacc
aagatccagagcatgagggaccaggccgactggctgctgcggaacatcatcccctaccac
gtggccgagcagctcaaggtgtcccagacctactccaagaaccacgacagcggaggcgtc
atcttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaag
gagtgctacagggtcctcaacgagctgatcggggactttgacgagctcctgagcaagccg
gactacagcagcatcgagaagatcaagaccatcggggccacgtacatggccgcgtccggg
ctgaacgccacgcagtgccgcgacggcagccacccgcaggagcacctgcagatcctcttc
gagttcgccaaggagatgatgcgtgtggtggacgacttcaacaacaacatgctgtggttc
aacttcaagctcagggtgggcttcaaccacgggcccctgacggcgggcgtcatcggcacc
accaagctgctgtacgacatctggggggacacggtcaacatcgccagcaggatggacacc
acgggggtggagtgccgcatccaggtcagcgaggagagctaccgcgtcctgagcaagatg
ggctacgagttcgactaccgagggacggtgaatgtcaagggcaaaggccaaatgaagacc
tacctgtaccccaagtgcacagacagtgggttggtgccacagcaccagctgtccatctca
cccgacatccgggtccaggtggatggcagcatcggacgctcccccacagacgagatagcc
agcctggtgccttccgttcagaacccggaccaggtgtccccgggttccgagaacaacgcc
cagaccagggacgctcacccgtctgctaagagaccctggaaggagccagtcagagccgag
gaaaggtgtcggttcggcaaagccatagagaaaagcgactgtgaagaagtggggatggag
gaagccaacgaactcacgaagctcaacgtctcagagagggcgtga

KEGG   Bos mutus (wild yak): 102286168
Entry
102286168         CDS       T02919                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom01100  Metabolic pathways
bom01522  Endocrine resistance
bom04015  Rap1 signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04072  Phospholipase D signaling pathway
bom04114  Oocyte meiosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04261  Adrenergic signaling in cardiomyocytes
bom04270  Vascular smooth muscle contraction
bom04371  Apelin signaling pathway
bom04540  Gap junction
bom04611  Platelet activation
bom04713  Circadian entrainment
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04724  Glutamatergic synapse
bom04725  Cholinergic synapse
bom04727  GABAergic synapse
bom04742  Taste transduction
bom04750  Inflammatory mediator regulation of TRP channels
bom04911  Insulin secretion
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04916  Melanogenesis
bom04918  Thyroid hormone synthesis
bom04921  Oxytocin signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04925  Aldosterone synthesis and secretion
bom04926  Relaxin signaling pathway
bom04927  Cortisol synthesis and secretion
bom04928  Parathyroid hormone synthesis, secretion and action
bom04934  Cushing syndrome
bom04935  Growth hormone synthesis, secretion and action
bom04970  Salivary secretion
bom04971  Gastric acid secretion
bom04972  Pancreatic secretion
bom04976  Bile secretion
bom05032  Morphine addiction
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102286168 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102286168 (ADCY4)
   04371 Apelin signaling pathway
    102286168 (ADCY4)
   04020 Calcium signaling pathway
    102286168 (ADCY4)
   04072 Phospholipase D signaling pathway
    102286168 (ADCY4)
   04024 cAMP signaling pathway
    102286168 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102286168 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102286168 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102286168 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102286168 (ADCY4)
   04062 Chemokine signaling pathway
    102286168 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102286168 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102286168 (ADCY4)
   04912 GnRH signaling pathway
    102286168 (ADCY4)
   04913 Ovarian steroidogenesis
    102286168 (ADCY4)
   04915 Estrogen signaling pathway
    102286168 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102286168 (ADCY4)
   04921 Oxytocin signaling pathway
    102286168 (ADCY4)
   04926 Relaxin signaling pathway
    102286168 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102286168 (ADCY4)
   04918 Thyroid hormone synthesis
    102286168 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102286168 (ADCY4)
   04916 Melanogenesis
    102286168 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102286168 (ADCY4)
   04927 Cortisol synthesis and secretion
    102286168 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102286168 (ADCY4)
   04270 Vascular smooth muscle contraction
    102286168 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102286168 (ADCY4)
   04971 Gastric acid secretion
    102286168 (ADCY4)
   04972 Pancreatic secretion
    102286168 (ADCY4)
   04976 Bile secretion
    102286168 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102286168 (ADCY4)
   04727 GABAergic synapse
    102286168 (ADCY4)
   04725 Cholinergic synapse
    102286168 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102286168 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102286168 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102286168 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102286168 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102286168 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102286168 (ADCY4)
   04714 Thermogenesis
    102286168 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286168 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102286168 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102286168 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102286168 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286168 (ADCY4)
   05163 Human cytomegalovirus infection
    102286168 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102286168 (ADCY4)
Enzymes [BR:bom01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102286168 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102286168
NCBI-ProteinID: XP_005910346
UniProt: L8HRR9
LinkDB
Position
Un
AA seq 1077 aa
MARLFSPRQPPSEDLFYETYYSLSQQYPLLLLLLLIVLLGLLALLPVAWASGRELAADPA
FLTTVLCALGGFSLLLVLASREQRLQRWTRPLSGLVWAALLALGHSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLDMRDAITAGVTSSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNAAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
EEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPWAAEEDEKGTAGGLLSSLEGSKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALSSFSPQWSLDRSRTMRGPDEELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALTITYGITFLLFFLLLFVCFSEYLMKCVLKGPKMLHWLPTLSVLVATRP
GLRVALGTATILLVFVMAITSLVFLPATSACPFQAPNMSSMASNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSIFLHSHAWLSDCLIARLYLGTLDS
RPGVLKEPKLMGAVSFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLNATSGQDAQQDAEQSCGHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccacggcagccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctgctgctgctgctgatcgtgctcttgggg
ctcctggcgctgctccctgtggcctgggcaagtggcagggagctggccgcagacccagcc
ttcctgaccactgtgctgtgcgctctgggtggcttctcactgctgctggtcctggcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtcaggcctcgtgtgggcagcactg
cttgcactaggccacagcttcctgttcactgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctctttgtcatcttcactgtgtatgccatgttgcccctggacatgcgggac
gccatcaccgcgggtgtcacctcctcactctcacacttgctggtccttgggctgtatctt
gggcctcagcccgactctcggccggcgctgctgccacagctggctgcaaacgcggtgctg
ttcctgtgcgggaacgcggccggagcctatcacaaggcgctgatggagcgcgcgctgcgc
gccacgttccgggaggcgcttagttccctgcactcgcggcggagactggacaccgagaag
aagcatcaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gaggagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgagactggccagtgagtgctcccctaaggagttggtgcttatgctcaacgag
ctctttggcaagttcgaccaaatcgccaaggagcacgaatgcatgcggatcaagatccta
ggagactgttactactgtgtctccggcctgccgctctcactgcctgaccacgccatcaac
tgtgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccacaggc
gtggatatcaacatgcgtgtgggcgtgcactcaggcagcgtgctctgcggggtcatcggg
ctacagaaatggcagtatgatgtctggtcccatgacgtcactctggccaaccacatggag
gcgagtggagtgccaggacgagtacatatcacaggggctacgctggccctgctggccggg
gcttatgctgtggaggatgcagccatggaacaccgggacccataccttcgggagctaggg
gagccgacctacctggtcatcgacccctgggctgcagaggaggacgagaagggtactgca
ggagggttgctgtcctctcttgagggctccaagatgcgtccatcactgctgatgacccgc
tacctggagtcctggggtgcagccaagcctttcgcccacctgagccacgtggagagccct
gtgtccacatctacccctctcccggagaaggccctgtcttccttcagcccccagtggagc
ctggaccggagccgtaccatgaggggacctgatgaggaactagacactggggatgccaag
ttcttccaggtcatcgaacagctcaattctcagaaacaatggaaacagtcgaaggacttc
aatccactgacactgtacttcagagagaaggagatggagaaagagtatcggctctctgca
ctccccgccttcaaatactatgcagcctgcaccttcctggtttttctctccaacttcatt
atccagatgctggtgacaaacaggcctccagctctgaccatcacctatggcatcaccttc
ctcctcttcttcctcctcctcttcgtctgcttctcagagtacctgatgaagtgtgtcttg
aaaggccccaagatgctgcactggctacccaccctgtctgtcctggtggccacacggcca
ggactgcgagtggctctgggcaccgctaccatcctgctcgtcttcgtcatggccattacc
agtctggtcttcttaccagcaacatcagcctgcccttttcaggctcccaatatgtcttcc
atggcttccaacctctcctgggagctccctgggtccctgcctctcatcagcatcccatac
tccatgcactgctgcgtgttgggcttcctctcctgctccctcttcctgcacatgagcttt
gagctgaagctgctgctgctcctgctgtggctgacggcctcctgctccatcttcctgcac
tcccacgcctggttgtccgactgcctcatcgcccgcctctacctgggcaccttggactcc
aggccaggggtgctgaaggagcccaaactgatgggagcagtctccttcttcatcttcttc
ttcaccctcctagtcctggctcggcagaatgaatattactgccgcctggactttctgtgg
aagaagaagctgaggcaagagcaggaggagacagagacaatggagaacctgactcggctg
ctcttggagaacgtgctccctgcgcacgtggccccccagttcattggtcagaatcggcgc
aatgaggacctctaccaccagtcctatgagtgtgtgtgtgtcctcttcgcctcggtccca
gacttcaaggagttctactctgaatccagcatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgagataatcgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaaaactatctgcagcacctacatggcagctaccggcttgaacgccacc
tctggacaggatgcacagcaggatgctgagcaaagctgcggccaccttggcaccatggta
gagtttgctgtggcccttgggtctaagctggatgtcatcaacaagcactcattcaacaac
tttcgcttgcgtgtagggttaaaccacggacctgtagtggctggagtgattggggcccag
aaaccacaatatgacatctggggcaacacggtgaatgtggccagccgcatggagagcaca
ggtgtcctgggcaagattcaggtaacagaagagacagcctgggccctccagtccttaggc
tacacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcttgaacacagatttgacacgaactggacctccctcagccaccctaggctga

DBGET integrated database retrieval system