KEGG   Bos mutus (wild yak): 102265482Help
Entry
102265482         CDS       T02919                                 

Gene name
CLEC6A
Definition
(RefSeq) C-type lectin domain family 6 member A
  KO
K17514  C-type lectin domain family 6 member A
Organism
bom  Bos mutus (wild yak)
Pathway
bom04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102265482 (CLEC6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:bom04054]
    102265482 (CLEC6A)
   04091 Lectins [BR:bom04091]
    102265482 (CLEC6A)
Pattern recognition receptors [BR:bom04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   102265482 (CLEC6A)
Lectins [BR:bom04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    102265482 (CLEC6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 102265482
NCBI-ProteinID: XP_014337885
LinkDB All DBs
Position
Un
AA seq 170 aa AA seqDB search
MVREGNAESCFRMRLWCIAVLGLALLSACFIVSCVEKIWGCCPGTWKPFGSSCYFISSEE
NFWAKSEQNCIGMGAHLVVINTETEQDFIIQQLNKTXFLGLSDPQGNDNWQWIDQTPYKE
NVRFWHQNEPNFSAEECASVVFWDGRGWGWNDVFCDSKRKSICEMKKIYL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgggaagggaatgcagaatcctgcttccggatgaggctctggtgtattgcagta
cttggcttagccctcctcagtgcatgtttcattgtgagctgtgtggaaaagatttgggga
tgttgcccaggtacctggaagccgtttggttccagctgctactttatttcttctgaagag
aatttctgggctaagagtgagcagaactgcattgggatgggagctcacttggtggtgatc
aacacagaaacagagcaggatttcattatccagcagctgaataaaacannttttctggga
ctctcagacccacaagggaatgacaactggcaatggattgatcagacaccttacaaggaa
aatgtcagattttggcaccaaaatgaacccaacttttctgcagaggaatgtgcttcagtt
gttttctgggatgggagaggatggggctggaatgatgttttctgtgattctaaaaggaaa
tcaatatgtgagatgaagaagatttacctatga

DBGET integrated database retrieval system