KEGG   Bos mutus (wild yak): 102265567
Entry
102265567         CDS       T02919                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04060  Cytokine-cytokine receptor interaction
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04218  Cellular senescence
bom04350  TGF-beta signaling pathway
bom04390  Hippo signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05144  Malaria
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05321  Inflammatory bowel disease
bom05323  Rheumatoid arthritis
bom05410  Hypertrophic cardiomyopathy
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102265567 (TGFB3)
   04350 TGF-beta signaling pathway
    102265567 (TGFB3)
   04390 Hippo signaling pathway
    102265567 (TGFB3)
   04068 FoxO signaling pathway
    102265567 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102265567 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102265567 (TGFB3)
   04218 Cellular senescence
    102265567 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102265567 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102265567 (TGFB3)
   05212 Pancreatic cancer
    102265567 (TGFB3)
   05225 Hepatocellular carcinoma
    102265567 (TGFB3)
   05226 Gastric cancer
    102265567 (TGFB3)
   05220 Chronic myeloid leukemia
    102265567 (TGFB3)
   05211 Renal cell carcinoma
    102265567 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102265567 (TGFB3)
   05321 Inflammatory bowel disease
    102265567 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102265567 (TGFB3)
   05414 Dilated cardiomyopathy
    102265567 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102265567 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102265567 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102265567 (TGFB3)
   05161 Hepatitis B
    102265567 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102265567 (TGFB3)
   05144 Malaria
    102265567 (TGFB3)
   05145 Toxoplasmosis
    102265567 (TGFB3)
   05140 Leishmaniasis
    102265567 (TGFB3)
   05142 Chagas disease
    102265567 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102265567 (TGFB3)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102265567 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102265567
NCBI-ProteinID: XP_005889692
LinkDB
Position
Un
AA seq 452 aa
MHLLAKPQSSGSREAAWFSSLLLHDCRGLLLPGLAAFLPGPRLKMHLQRALVVLALLNFA
TVRLSMSTCTTLDFNHIKRKRVEAIRGQILSKLRLTSPPDPSGLASVPIQVLDLYNSTRE
LLEEVHGERGDVCTQANTESEYYAKEIYKFDMIQGLEEHNDLTVCPKGITSKIFRFNVSS
VEKNETNLFRAEFRVFRMPNPASKRSEQRIELFQILQPGEHIAKQRYIDGKNLPTRGTGE
WLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQELMEIKFKGVDSDDD
PGRGDLGRLKKKKEHIPHLILMMIPPNRLDSPGHSQRKKRALDTNYCFRNLEENCCVRPL
YIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSSDTTHSTVLGLYNTLNPEASASPCCVP
QDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcctggttttcctcc
ctccttctgcacgactgccggggtctcctcctgccaggccttgcggcctttctccctggc
ccccgcctgaagatgcacttgcagagggctctggtggtcctggccctgctgaactttgcc
acggtccgcctctccatgtccacttgcaccaccttggacttcaaccacatcaagaggaag
cgggtggaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgat
ccatccgggttggccagtgtccccatccaggtcctggatctttacaacagcacccgagag
ctactggaggaggtgcatggggagaggggagacgtctgcacgcaagcaaacaccgagtcg
gagtattatgccaaagaaatctataaattcgacatgatccaggggctggaggagcacaat
gacctgaccgtctgccccaaaggcatcacctccaagattttccgcttcaacgtgtcctca
gtggagaaaaacgaaaccaacctgttccgagcagaattccgggtctttcggatgcccaac
cctgcctccaagcgcagcgagcagaggattgagctcttccagatcctccagccgggtgag
cacatagccaagcagcggtatatcgatggcaagaacctgcccacgcggggcactggcgag
tggctgtctttcgacgtcacagacactgtgcgtgaatggctcttgcggagagaatccaac
ttaggtctggaaatcagcatccactgtccctgtcacacctttcagcccaatggggatatc
ctggaaaacattcaagagctgatggaaatcaaattcaaaggtgtggacagcgatgatgat
ccgggccgcggagatctggggcgacttaagaagaagaaggaacacatccctcatctaatc
ctcatgatgattcccccaaaccggctagacagcccaggccacagtcagaggaagaagcgg
gccctggacaccaattactgcttccgcaatttggaggagaactgctgtgtgcgtcctctc
tacattgacttccgacaggatctgggctggaaatgggtccatgaacctaagggctactat
gccaacttctgctcaggcccatgcccatacctccgcagctcagacacaacccacagcacg
gtgctgggcctgtacaacactctgaaccctgaagcctcagcctccccttgctgcgtaccc
caggacttggagcccctgaccatcctgtactatgtcgggaggacccccaaagtggagcag
ctgtctaacatggtggtgaagtcctgcaagtgcagctga

KEGG   Bos mutus (wild yak): 102283357
Entry
102283357         CDS       T02919                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04060  Cytokine-cytokine receptor interaction
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04218  Cellular senescence
bom04350  TGF-beta signaling pathway
bom04380  Osteoclast differentiation
bom04390  Hippo signaling pathway
bom04659  Th17 cell differentiation
bom04672  Intestinal immune network for IgA production
bom04926  Relaxin signaling pathway
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05144  Malaria
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05321  Inflammatory bowel disease
bom05323  Rheumatoid arthritis
bom05410  Hypertrophic cardiomyopathy
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102283357 (TGFB1)
   04350 TGF-beta signaling pathway
    102283357 (TGFB1)
   04390 Hippo signaling pathway
    102283357 (TGFB1)
   04068 FoxO signaling pathway
    102283357 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102283357 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102283357 (TGFB1)
   04218 Cellular senescence
    102283357 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102283357 (TGFB1)
   04672 Intestinal immune network for IgA production
    102283357 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102283357 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102283357 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283357 (TGFB1)
   05205 Proteoglycans in cancer
    102283357 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102283357 (TGFB1)
   05212 Pancreatic cancer
    102283357 (TGFB1)
   05225 Hepatocellular carcinoma
    102283357 (TGFB1)
   05226 Gastric cancer
    102283357 (TGFB1)
   05220 Chronic myeloid leukemia
    102283357 (TGFB1)
   05211 Renal cell carcinoma
    102283357 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102283357 (TGFB1)
   05321 Inflammatory bowel disease
    102283357 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102283357 (TGFB1)
   05414 Dilated cardiomyopathy
    102283357 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102283357 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102283357 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102283357 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102283357 (TGFB1)
   05161 Hepatitis B
    102283357 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102283357 (TGFB1)
   05144 Malaria
    102283357 (TGFB1)
   05145 Toxoplasmosis
    102283357 (TGFB1)
   05140 Leishmaniasis
    102283357 (TGFB1)
   05142 Chagas disease
    102283357 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bom03110]
    102283357 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102283357 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102283357 (TGFB1)
Chaperones and folding catalysts [BR:bom03110]
 Intramolecular chaperones
  Others
   102283357 (TGFB1)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102283357 (TGFB1)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102283357 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102283357
NCBI-ProteinID: XP_005890676
UniProt: L8IY61
LinkDB
Position
Un
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLMLTPGRPVAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGDVPPGPLPEAILALYNSTRDRVAGESAETEPEPEADYYAKEVTRVLMVEYGNKI
YDKMKSSSHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTRREEIEGFRLSAHCSCDSKDNTLQVDINGFS
SGRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctcctgccgctgctgctgccgctgctgtggctactaatg
ctgacgcctggccggccggtcgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagattttgtccaagcttcggctcgcc
agccccccgagccagggggatgtgccacccggcccgctgcccgaggccatactggccctt
tacaacagtacccgcgaccgggtggccggggaaagtgccgaaacggagcctgaaccagag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaatacggcaacaaaatc
tatgacaaaatgaagtctagctcgcacagcatatatatgttcttcaacacgtctgagctc
cgggaagcggtgcccgaacctgtgttgctctctcgggcagagctgcgcctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatatagcaacaattcctggcgc
tacctcagcaaccggctgctcgcccccagcgactcaccggagtggctgtcctttgacgtc
actggagttgtgcggcagtggctgacccgcagagaggaaatagagggctttcgcctcagt
gcccactgttcctgtgacagtaaagataacacgcttcaagtggacattaacgggttcagt
tccggccgccggggtgacctcgccaccattcacggcatgaaccggcccttcctgctcctc
atggccacccctctggagagggcccagcacctgcacagctcccgccaccgccgagccctg
gacaccaactactgcttcagctccacagaaaagaactgctgtgttcgtcagctctacatt
gacttccggaaggacctgggctggaagtggattcatgaacccaaggggtaccacgccaat
ttctgcctggggccctgcccttacatctggagcctggatacacagtacagcaaggtcctg
gccctgtacaaccagcacaacccgggcgcttcggcggcgccgtgctgcgtgcctcaggcg
ctggagcccctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagttgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Bos mutus (wild yak): 102283491
Entry
102283491         CDS       T02919                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04060  Cytokine-cytokine receptor interaction
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04218  Cellular senescence
bom04350  TGF-beta signaling pathway
bom04380  Osteoclast differentiation
bom04390  Hippo signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05144  Malaria
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05321  Inflammatory bowel disease
bom05323  Rheumatoid arthritis
bom05410  Hypertrophic cardiomyopathy
bom05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102283491 (TGFB2)
   04350 TGF-beta signaling pathway
    102283491 (TGFB2)
   04390 Hippo signaling pathway
    102283491 (TGFB2)
   04068 FoxO signaling pathway
    102283491 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102283491 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102283491 (TGFB2)
   04218 Cellular senescence
    102283491 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102283491 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283491 (TGFB2)
   05206 MicroRNAs in cancer
    102283491 (TGFB2)
   05205 Proteoglycans in cancer
    102283491 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102283491 (TGFB2)
   05212 Pancreatic cancer
    102283491 (TGFB2)
   05225 Hepatocellular carcinoma
    102283491 (TGFB2)
   05226 Gastric cancer
    102283491 (TGFB2)
   05220 Chronic myeloid leukemia
    102283491 (TGFB2)
   05211 Renal cell carcinoma
    102283491 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102283491 (TGFB2)
   05321 Inflammatory bowel disease
    102283491 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102283491 (TGFB2)
   05414 Dilated cardiomyopathy
    102283491 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102283491 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102283491 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102283491 (TGFB2)
   05161 Hepatitis B
    102283491 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102283491 (TGFB2)
   05144 Malaria
    102283491 (TGFB2)
   05145 Toxoplasmosis
    102283491 (TGFB2)
   05140 Leishmaniasis
    102283491 (TGFB2)
   05142 Chagas disease
    102283491 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bom04052]
    102283491 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102283491 (TGFB2)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102283491 (TGFB2)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102283491 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 102283491
NCBI-ProteinID: XP_005898630
UniProt: L8IDU1
LinkDB
Position
Un
AA seq 442 aa
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSFLPSETVCPV
VTTPSGSVGSLCSRQSQVFCGYLDAIPPTFYRPYFRIVRFDVSSMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKSPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcgtttctgctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggaatactacgcc
aaggaggtttacaaaatagacatgccgtccttcttaccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggttttctgt
gggtaccttgatgccatcccgcccactttctacagaccgtactttagaattgtccgattt
gacgtctcctcgatggagaagaatgcttccaatttggtgaaggccgagttcagagtcttt
cgtttacagaacccaaaagccagagtgcctgaacaacggatcgagctgtatcagattctc
aaatccaaagatttaacatctccaacccagcgctacattgacagcaaagtcgtgaaaacc
agagcagagggcgaatggctctccttcgacgtcactgatgctgttcacgaatggctccac
cataaagacaggaacctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatcgaataattacatcatccccaataaaagtgaagaactagaagcacgctttgcaggt
attgatggcacctctacctataccagtggtgatcagaaaacaataaagtccactaggaaa
aaaaacagtgggaagagcccacatctcctgctaatgttgttgccctcctacagacttgag
tcccaacagtccaaccggcggaagaagcgcgctctggatgcagcctattgctttagaaat
gtgcaggataattgttgcctacgcccactttacattgatttcaagagggatcttgggtgg
aaatggattcatgagcctaaagggtacaatgccaacttctgtgctggagcatgcccatat
ctgtggagctcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcgtctgcttccccttgctgcgtgtcccaagatttagagccgctcaccattctctac
tacattggcaaaacacccaagatcgaacagctttctaatatgattgtcaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system