KEGG   Bos mutus (wild yak): 102265893
Entry
102265893         CDS       T02919                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00220  Arginine biosynthesis
bom00330  Arginine and proline metabolism
bom01100  Metabolic pathways
bom04020  Calcium signaling pathway
bom04066  HIF-1 signaling pathway
bom04146  Peroxisome
bom04371  Apelin signaling pathway
bom04926  Relaxin signaling pathway
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05022  Pathways of neurodegeneration - multiple diseases
bom05133  Pertussis
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05200  Pathways in cancer
bom05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102265893 (NOS2)
   00330 Arginine and proline metabolism
    102265893 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102265893 (NOS2)
   04066 HIF-1 signaling pathway
    102265893 (NOS2)
   04020 Calcium signaling pathway
    102265893 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102265893 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102265893 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102265893 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102265893 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102265893 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102265893 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    102265893 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102265893 (NOS2)
   05152 Tuberculosis
    102265893 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102265893 (NOS2)
   05145 Toxoplasmosis
    102265893 (NOS2)
   05140 Leishmaniasis
    102265893 (NOS2)
   05142 Chagas disease
    102265893 (NOS2)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102265893 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102265893
NCBI-ProteinID: XP_005896747
LinkDB
Position
Un
AA seq 1156 aa
MACPWQFLFKIKSQKVDLATELDINNNVGKFYQPPSSPVTQDDPKRHSPGKHGNESPQPL
TGTVKTSPESLSKLDAPPSACPRHVKIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIM
NPKSLTIGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVLPLVLQADGRDPELFEIPPDLVLEVPMEHPRYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEVGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDERRRPQRRGIRFKVLVKAVFFASVLMHKAMASRVRAT
ILFATETGRSETLAQDLGALFSCAFNPKVLCMDQYQLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLLMLKELTNTFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVSGKHHIEIPKLYTSNVTWDPQHYRLMQDSEPLDL
NKALSSMHAKHVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQAPSYLPGEHLGVFPCNQ
PALVQGILERVVDGPAPHQPVRLETLCENGSYWVKDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAEKQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PILKPRYYSISSSRDLTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSASGFQLPEDRSRPCILIGPGTGIAPFRSFWQQRLHEAEHKGLQGGRMTLVFGCRRPE
EDHLYWEEMLEMARKGVLHEVHTAYSRLPDQPKVYVQDILRQRLAGEVLRVLHEEQGHLY
VCGDVRMARDVARTLKQLMATALSLNEEQVEDYFFQLKNQKRYHEDIFGAVFPYEVKKDG
TAGLPSNPRAPGTHRS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaaatcaaatcccaaaaggtggacttggctacg
gaactggacatcaacaacaatgtgggaaaattctaccagcccccgtccagtccagtgaca
caggatgaccccaaacgtcacagcccgggcaagcacgggaatgagtctccccagcccctc
acggggacagtaaagacgtctccagaatccctgagcaagctggacgcacccccgtcagcc
tgtccacggcatgtgaagatcaaaaactggggcagcggagtgactttccaagacacgctt
caccagaaggccaaaggggatctctcttgcaagtccaagtcttgcctggcatccatcatg
aaccccaaaagtttgaccataggaccccgggacaagccaacccccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgccccccgctgc
atcggaaggatccagtggtcgaacctgcaggtctttgacgcccggagctgttccacggcc
caggaaatgttcgaacacatctgcagacacgtgcgttatgccaccaacaacggcaacatc
aggtcggccatcactgtgttcccccagcggagtgatgggaagcatgacttccgggtctgg
aacgcccagctcatccgctatgccggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggagttcacacagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgacgtgttgcctctagtcctgcaggctgacggccgtgacccagagctcttcgaa
atcccccctgaccttgtgctcgaggtgcccatggaacatcccaggtacgaatggttccgg
gagctggagctcaagtggtacgccctgccagccgtggccaacatgctgcttgaggtgggc
ggcctcgagttcccagggtgccccttcaacgggtggtacatgggcacagaagttggagtc
cgggacttctgcgacgtccagcgatacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacgcacaaggtggcctcactctggaaggaccgggctgtcgttgagatcaacgtc
gctgtgctccacagtttccagaagcagaacgtgaccatcatggaccaccactccgctgca
gagtccttcatgaagtacatgcagaatgagtaccgctcccgagggggctgcccagctgac
tggatttggctggtccccccgatctctggaagcatcacccccgtgttccaccaggagatg
ttaaattacgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaggacgagaggcggagaccccagagaagagggattcgattcaaagtcttggtcaaa
gctgtgttcttcgcctcggtgctgatgcataaggccatggcatcccgggtcagagccacg
atcctctttgcaacagagacggggagatcggaaacgctggcccaggacctgggggctttg
ttcagctgtgccttcaaccccaaggttctctgcatggatcagtaccagctgagccatctg
gaggaggagcagctgctgctggtggtgaccagcacttttggcaacggagactcccctggc
aacggagagaaactgaagaagtccctcttgatgctgaaagaactcaccaacacgttccgg
tacgccgtgtttggccttggctccagcatgtaccctcagttctgcgcttttgctcatgac
attgaccagaagttgtcccagctgggagcttctcagcttgccccaaccggggaaggggac
gaactcagcgggcaggaggaggcctttcgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacattcgatgtcagcggcaagcaccacattgagatccccaagctctacacttcc
aatgtgacctgggacccgcagcactacaggctcatgcaggactcagagcctctggacctc
aacaaagccctgagcagtatgcacgccaagcatgtgttcaccatgaggctcaaatcgcag
cagaatctgcagagtccgaaatccagccgcaccaccctcctggtggaactctcctgtgag
ggcagccaagctccaagctacctgccgggagagcacctcggagttttcccatgcaaccag
ccggccctggttcaaggcatccttgagcgagtggtggatggccctgccccgcaccagcct
gtgcgcctggagaccctctgtgagaatggcagctactgggtcaaggataagcggctgcca
ccttgctcactcagccaggctctcacctatttcctggacatcaccaccccgccaacccag
ctgctgctccgaaagctggcccagctggccacagaagaggctgagaagcagaggctggag
accctatgccagccctcagattacaacaagtggaagttcaccaacagccccacatttctg
gaggtgctggaggagttcccgtccctgcgggtgtctgccagcttcctgctctcccagctc
cctattctgaagccccggtactactccatcagctcctccagggacctcacacccacggag
atccacctcactgtggccgtgctcacgtaccgcacccgagatggccaaggtcccctgcac
catggcgtctgcagcacgtggctcagcagcttgaagccccaagacccggtgccctgcttt
gtgcgaagtgccagcggcttccagcttcccgaggaccgctcccgtccttgcatcctcatt
gggcccggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgaggct
gagcacaaagggctccagggcggccgcatgaccctggttttcgggtgccgccgcccagaa
gaggaccacctctactgggaggagatgctggagatggcccgcaagggggtgctgcacgag
gtgcacaccgcctattcccgcctgcctgaccagcccaaggtctatgttcaagacatcctg
cggcagcggctggcgggcgaggtgcttcgcgtgctgcacgaggagcaaggccacctctat
gtctgtggggatgtgcgcatggcccgggacgtggcccgcaccctgaagcagctgatggct
actgcgctgagcctgaatgaggaacaggtggaggactatttcttccagctcaagaaccag
aagcgctatcatgaagacatctttggtgctgtatttccctatgaggtgaaaaaggatggg
acagcagggctgcccagcaatcccagagctccaggcacccacagaagttaa

DBGET integrated database retrieval system