KEGG   Bos mutus (wild yak): 102265977Help
Entry
102265977         CDS       T02919                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00052  Galactose metabolism
bom00500  Starch and sucrose metabolism
bom01100  Metabolic pathways
bom04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102265977 (MGAM)
   00500 Starch and sucrose metabolism
    102265977 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102265977 (MGAM)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102265977 (MGAM)
    3.2.1.20  alpha-glucosidase
     102265977 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102265977
NCBI-ProteinID: XP_014339001
LinkDB All DBs
Position
Un
AA seq 1559 aa AA seqDB search
MARKKLKKFTTLELMLSILLLVVFIITIPIFVLSARDSLESQDPGTTVSPDSGTSTTPGS
AECPVVNDSERINCIPDQSPTKATCDQRGCCWSPQGTISMPWCYYSKSHGYQVGGDLVNT
NAGFTAQLKRLSSPLFGNDVNNVLLTAEYQTSNRFHFKLTDQNQNRYEVPHEHVQPFTGN
AASSLTYKVEVSKQPFGIKVIRTSNNRVLFDSSIGPLLFAHQFLQLSIRLPSANVYGLGE
HVHQQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLLNSNAME
VFLQPTPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPALPSYWALGFHLSRYDYG
TLDNMKEVVERNRAAQLPYDVQHADIDYMDARKDFTYDPVAFKGFPEFVKELHNNGQKLV
IIVDPAISNNSSLSNPYGPYDRGSDMKIWVNTSDGVTPLIGEVWPGKTVFPDYTNPKCTA
WWTNEFELFHSQVEFDGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPKILDGYLFSKSI
CMDAVQHWGQHYDVHNLYGYSMAIATAETVKTVFPNKRSLILTRSTFAGSGKFAAHWLGD
NAATWSDLRWSIPGMLEFNLFGIPMVGADICGFMLDTSEELCRRWMQLGAFYPFSRNHNG
QGYKAQDPASFGPDSLLLNSSRHYLTIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYQD
SNTWDVHQQFLWGPGLLITPVLDEGAEKVTAYMPDAVWYDYETGGQVRWRKQKVEMELPG
DKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDENKEAKGELFWDDGETKDTVANN
LYLLCEFSVTQNRLEVKILQSTYTDPNDLAFKEIKILGTQEPNKVTVKQNGVPVQVSPNV
TYDSNLQVALITEIDLVLGGTYTVEWDVKIRDEEKIDCYPDETGVSAENCTARGCAWEEP
SSHGVPFCYFVNDLYSVSDVQYDSHGASAVISLKTSLYAHSFPSVPVNSLRLTVTYHKDN
MLQFKMYDPSNNRYEVPVPLNIPSVPSGTSESQLYAVLIKKNPFGIEIRRKSTGTVIWDS
QLLGFTFNDMFIRISTRLPSKYLYGFGETEHTAFRRDLEWNTWGMFSRDQPPGYKKNSYG
VHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVVLGPTPELVTQQ
YTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDAMVAAQIPYDVQYSDIDYMERQLD
FTLDAEFEGFPALITRMRADGMRVIIILDPAISGNETKPYLPFTRGVEDDVFIKDPSDGS
IVWGKVWPDFPDVVINSSLDWDSQVEKYRAFVAFPDFFRNSTTTWWKRELRELYTNPREP
EKSLKFDGLWIDMNEPASFVNGAVPPGCKDATLNHPPYMPYLESRDRGLSSKTLCMESQQ
VLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDHD
VDGNIFQKSLTGPFYSILFQTGADICGFFQDAEYEMCARWMQIGAFYPFARNHNTIGTR
NT seq 4677 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaagttcactactttggagcttatgctcagtattcttctg
cttgtggtgtttatcatcactattcccatcttcgtgctttcagccagagattccctggaa
tcacaagatcctgggacgacagttagcccagattctgggacaagtaccacccctggttct
gctgagtgcccagtggtaaatgactctgaacggataaactgcatccctgaccaatcacca
acaaaggctacctgtgaccagcgtggctgttgctggagtcctcagggaaccataagtatg
ccctggtgctactattctaaaagtcatggctatcaagtagggggcgacctcgtgaacaca
aatgcaggattcacagcccagctgaaaaggttgtcttcacctctgtttggaaatgatgtc
aacaatgtccttctcacagcagaataccagacatctaaccgtttccattttaagttaact
gaccaaaaccagaacagatacgaagtgccccatgaacatgtgcaacccttcacaggaaat
gctgcctcttccttgacgtataaagttgaggtctccaaacagccatttggcatcaaagtg
atcagaacgagcaacaatcgtgttctgtttgactccagcatcgggcccctgctgtttgct
caccagttcctgcagctctccatccgactgcctagtgccaacgtgtatgggctgggagaa
cacgtgcaccagcagtaccggcatgacatgaactggaagacctggcccatatttgccagg
gacacaacccccaatggggatggaactaacttgtatggtgcacagacgttcttcctatgc
cttgaagatgctagcggattgtcctttggagtgtttctgctgaacagcaatgccatggag
gttttcctccagcccaccccagctgtcacttaccgcaccattgggggcattcttgacttc
tacgtgttcttggggaatactccagagcaagttgttcaagaatatctagagctcgttgga
cggccagccctaccctcatactgggctcttggatttcatctcagtcgttatgactatgga
accctagataacatgaaagaagttgtggagagaaaccgtgctgcgcagctgccttatgat
gttcagcacgctgatattgattacatggacgcaagaaaggacttcacttatgatccagta
gctttcaagggcttccctgagtttgttaaagaattacacaataacggacagaaactggtc
atcattgtggatcctgccatctccaacaactcttccctaagtaatccctatggcccgtat
gaccggggttcagatatgaagatatgggtgaatacttcagatggggtgactccactcatt
ggggaggtctggcctggaaaaactgtgtttcctgattacaccaaccctaagtgtactgct
tggtggacaaatgaatttgagcttttccacagtcaagtagagtttgatggaatctggatt
gatatgaatgaagttgccaactttgtggatggctcagtttcaggatgttccacgagcaat
ctaaattatcccccattcactcccaaaatcctggatgggtacctgttcagcaagagcatc
tgcatggacgcagtgcagcactgggggcagcattacgacgtccacaatctgtacggctac
tccatggccatcgccactgcagaaactgtcaagactgtgttccccaacaagagaagcctc
attttaacccgttctacgtttgcgggttctggcaagtttgcagcccactggctaggagac
aatgccgccacctggagcgaccttcgatggtccatccctggcatgcttgagttcaacctg
tttggtatccccatggtgggcgctgacatatgtggctttatgctggatacttctgaagag
ctctgcagacggtggatgcagctgggagcgttctatccattttccaggaatcacaatggc
caaggctacaaggcccaggatccagcctcctttggccctgactcactgctgttgaattcc
tccaggcactacctgaccatccgctatacccttctgccctatctctacacactcttctac
cgtgctcacagccgcggggacaccgtggccaggccccttctgcatgagttctaccaggac
agcaacacctgggatgtgcaccagcagtttttatgggggccgggcctcctcatcactcca
gtcctggatgagggtgcagagaaagtgaccgcatacatgcctgacgctgtctggtatgac
tatgagactgggggccaagtgagatggaggaagcaaaaagtggagatggaacttcctgga
gacaaaattggacttcacctgcgaggaggctacatcttccccacgcagcagccagccacg
accacggtggccagtcgacggaaccctctcggtctaatcattgccctggatgagaacaaa
gaagcaaaaggcgaacttttctgggatgatggggaaacaaaagatactgtggccaacaac
ctttatctcttatgtgagttctccgtcacccaaaaccgcctggaggttaagattttgcaa
tcaacctacacagaccccaatgatttagcatttaaagaaattaaaatccttggaacccag
gagcctaacaaggttacagtgaaacagaacggtgttccggttcaagtttctcctaatgtc
acttacgattccaacctgcaggtggcccttatcacagaaattgatcttgttctgggagga
acatacacggtggagtgggatgtgaagataagggatgaagaaaaaatagactgttatcct
gatgagactggtgtttctgcagaaaactgcactgcccgcggttgtgcctgggaggagccc
agttctcatggagtccctttttgctatttcgtcaatgatctctactctgtcagtgatgtt
cagtatgactcacatggggcctcagctgtcatctccttaaagacttctctgtatgcccac
tccttcccctcagtacctgtgaactccctgcgcctgactgtgacctaccataaggataac
atgctgcagtttaagatgtatgatcccagcaacaaccggtatgaagttccagtccctctc
aacatacccagcgttccatctggcacctctgagagtcaactctatgctgtcctcattaag
aagaatccatttgggattgaaattcgccgcaagagtacaggcactgtcatctgggactct
cagctcctcggctttaccttcaatgacatgttcatccgcatctccacgcgcctcccctcc
aagtacctctatggctttggggaaactgagcacacagccttccgaagagacctggaatgg
aacacgtgggggatgttctcccgagaccaacccccggggtacaagaagaactcctatggt
gtccacccctactacatggcactggaggaggatggcagcgcccatggagtgctcctactg
aacagcaatgccatggacgtgaccttccagcccttgcctgccttgacataccgtaccaca
ggaggaattctggacttttatgtggttttagggccaactccagagcttgtcactcagcag
tacactgagttgatcggtcggccagtgatggttccttactggtccctggggtttcagctg
tgtcgctatggataccagaacgactctgagatcgccagcttgtacgatgctatggtggct
gcacagatcccctatgatgtgcagtattcggacattgactacatggagcggcagctggac
ttcacccttgatgccgagtttgaggggtttccagctctgattactcgcatgagggccgat
gggatgcgagtcattatcattctggacccagccatttctggcaacgagaccaagccctat
ctgccattcacacggggtgtagaggatgatgtcttcatcaaagatccgagtgatgggagc
attgtctggggaaaggtctggcctgattttcctgatgtggtaataaacagttctctagac
tgggacagtcaagtggagaaataccgggcatttgtggcctttccagactttttccgtaat
tcaaccaccacatggtggaagagggagttgagagaactgtacaccaatccacgggaacca
gagaagagcttgaagttcgatggcttgtggattgatatgaatgaaccagcgagcttcgtg
aatggagcagtccctccaggctgcaaggatgccactctgaaccaccctccctatatgcca
tatctggagtccagggaccggggcctgagcagcaagaccctgtgcatggagagccagcag
gtcctgcctgacggctcaccggtgcgccactacgacgtgcacagcctctacgggtgggcc
cagaccagacccacatacgaagctgtgcaggaggtgacgggacagcgagggatcgtcatc
actcgctccactttcccctcttctggccgctggggaggacactggctgggggatcacgat
gtagatggtaacatctttcagaaatcattaactggcccattttattctatcttgtttcag
acaggagcagatatttgtggattctttcaagacgctgaatatgaaatgtgtgctcgctgg
atgcaaataggggccttctaccccttcgcaaggaatcacaataccattgggaccagg

DBGET integrated database retrieval system