KEGG   Bos mutus (wild yak): 102265995
Entry
102265995         CDS       T02919                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04310  Wnt signaling pathway
bom04350  TGF-beta signaling pathway
bom04371  Apelin signaling pathway
bom04390  Hippo signaling pathway
bom04520  Adherens junction
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04659  Th17 cell differentiation
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05161  Hepatitis B
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102265995 (SMAD4)
   04350 TGF-beta signaling pathway
    102265995 (SMAD4)
   04390 Hippo signaling pathway
    102265995 (SMAD4)
   04371 Apelin signaling pathway
    102265995 (SMAD4)
   04068 FoxO signaling pathway
    102265995 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102265995 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102265995 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    102265995 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102265995 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102265995 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102265995 (SMAD4)
   05212 Pancreatic cancer
    102265995 (SMAD4)
   05225 Hepatocellular carcinoma
    102265995 (SMAD4)
   05226 Gastric cancer
    102265995 (SMAD4)
   05220 Chronic myeloid leukemia
    102265995 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102265995 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102265995 (SMAD4)
   05161 Hepatitis B
    102265995 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102265995
NCBI-ProteinID: XP_005896973
UniProt: L8IGB1
LinkDB
Position
Un
AA seq 553 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGG
DRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAG
RAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIA
PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEV
LHTMPIADPQPLD
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacattcgccaaaagagcaatt
gaaagtttagttaaaaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcaccctagcaagtgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcgcaagggatttcctcatgtgatctatgcccgtctctggagg
tggcctgaccttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacatacagcaccccagctctc
ttagctccatctgagtctaatgctaccagcaccaccaattttcccaacattcctgtggct
tccacaagtcagcccgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttat
catcataacagcactaccacctggacgggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatctccagcaccacccgcctatgccgccccatcccggacat
tactggccaccagttcacaatgagcttgcattccagcctcctatttctaatcatcctgct
cctgagtattggtgttccattgcttactttgagatggatgttcaagtaggagagacattt
aaagttccttcaagctgtcctattgttactgttgatggatatgtagacccttctggagga
gatcgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagca
aggttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtc
aggtgccttagtgaccacgcagtctttgtacagagctactacttagacagagaagctggg
cgtgcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgat
ttgcgtcagtgtcaccgtcagatgcagcagcaggcagccacggcacaagctgcagcagct
gcccaggcagcggccgtggcaggaaacatccccggcccagggtcagtaggtggaatagcc
ccagccatcagtttgtcggctgccgccgggatcggtgtggatgacctccgtcgtttgtgc
atactcaggatgagttttgtgaaaggctggggacctgattacccaagacagagcatcaag
gaaacaccttgttggattgagattcacttacaccgggccctccagctcctcgatgaagtc
cttcacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system