KEGG   Bos mutus (wild yak): 102266089
Entry
102266089         CDS       T02919                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102266089 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102266089 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102266089 (SOCS5)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102266089 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 102266089
NCBI-ProteinID: XP_005895678
UniProt: L8IMW1
LinkDB
Position
Un
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISLGDSAPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCAAEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEVNGDSSAVPQANCDSEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaagtacaggtgtcagaatctctttggt
catgagggaggaagccgtagtgaaaatgtggatatgaactccaacagatgtttgtctgtc
aaagagaaaaacatcagtttaggagactcagctcctcagcagcaaagcagtcccttaaga
gaaaacgttgccttacaactagggttaagcccttcaaagaattcttcaaggagaaaccaa
aactgtgccgctgaaattcctcagattgttgaaataagcattgaaaaggataatgactca
tgtgtcaccccaggaacaagacttgcaagaagagattcctactctcgacatgctccttgg
ggtgggaagaagaaacattcctgttctacaaagacacagagttcactggatacggataaa
aagtttggtagaactcgaagtggacttcaaaggagagagcggcggtacggcgtcagctcc
gtgcacgacatggacagtgtgtccagcaggactgtaggaagtcgctctctgagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaaaccc
ctattttctaataaaagaaaaatacatctttctgaattaatgcttgagaaatgccctttt
cctgctggctcagatttggcccagaaatggcatttgattaagcagcacacagcccctgtg
agcccacattcaacattttttgatacatttgatccatccttggtttctacagaagatgaa
gaagatcggcttcgagagagaaggcggcttagtattgaagaaggggtagaccccccgccc
aacgcacaaatacatacattcgaagccactgcacaggttaacccgttatataaactggga
ccaaagttagctcctggaatgactgaagtaaatggggacagttctgcagttccacaagct
aattgtgactcagaagaggacacaaccacgctgtgtttgcagtcacggaggcagaagcaa
cgtcaggtgtctggagacagccatgcccacgttagcagacagggagcctggaaagtccac
acgcagattgattacatacactgcctcgtgccggacttgctccagatcacaggtaatccc
tgttactggggagtgatggaccgctacgaagcagaagcccttctggaagggaaacctgag
ggtacatttttgctcagggactctgcacaagaggactacctcttctctgtgagcttccgt
cgctacaacaggtccctgcatgcccgaattgaacagtggaatcacaactttagtttcgat
gcccatgacccatgtgtgtttcactcctccactgtaacaggacttttggaacattacaaa
gaccccagctcttgcatgttttttgaaccattgcttacaatatcactaaacaggactttc
ccttttagcctgcagtacatctgccgtgcagtcatctgcagatgcacgacgtatgatgga
attgatgggctccctttaccatcgatgttacaggattttttaaaagagtatcattataaa
cagaaagttagagttcgctggctagaacgagaaccagtcaaagcaaagtaa

KEGG   Bos mutus (wild yak): 102268022
Entry
102268022         CDS       T02919                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
bom04910  Insulin signaling pathway
bom04917  Prolactin signaling pathway
bom04930  Type II diabetes mellitus
bom04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102268022 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102268022 (SOCS2)
   04917 Prolactin signaling pathway
    102268022 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    102268022 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102268022 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102268022 (SOCS2)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102268022 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 102268022
NCBI-ProteinID: XP_005889127
UniProt: L8IX53
LinkDB
Position
Un
AA seq 198 aa
MTLRCLESSGNGAEGAQSQWGTAGSAEEPSPEAARLAKALRELSHTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTSTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagtcctccgggaatggcgcggaaggggcgcagagccagtgg
gggaccgcggggtcggcggaggagccgtccccagaggcggcgcgtctggcgaaggccctg
cgggaactcagtcacacaggttggtactggggaagtatgactgttaatgaagccaaagag
aagttaaaagaggcaccagaaggaactttcttgattagagatagttcgcattcagactac
ctactaacaatatctgttaagacatcagctggaccaactaatcttcgcatcgaataccaa
gatgggaaatttagattggactctatcatatgtgtcaagtccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggccca
gaagccccccggaacggcactgttcacctttatctgaccaagccactctacacatcagca
ccacctctgcagcatctctgtagactcaccattaacaagtgtaccagcaccatctgggga
ctgcctttaccaacaagactaaaagattatttggaagaatataaattccaggtataa

KEGG   Bos mutus (wild yak): 102270424
Entry
102270424         CDS       T02919                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
bom04910  Insulin signaling pathway
bom04917  Prolactin signaling pathway
bom04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102270424 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102270424 (SOCS4)
   04917 Prolactin signaling pathway
    102270424 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102270424 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102270424 (SOCS4)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102270424 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 102270424
NCBI-ProteinID: XP_005905111
UniProt: L8I2R2
LinkDB
Position
Un
AA seq 440 aa
MAENSESNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVSAVEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPISPKSDEWVSTDLSQSELRDGQLKQRR
NMEEVSCFSHTSVQPCVITSNNSSGRGGPGTDSIVNLASNNSIEDSDMDSDDEIITLCTS
SRKRNKPKWEIDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaatagtgaaagtaatagtaaaaatgtagatgtaaggcccaaaactagccgg
agtcgaagtgctgacagaaaggatggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgaaagttgttcagatgctgaaacagtgagtgctgtcgagaaaactgaagtt
cctttaaggagccaagaaaggaagcacagctgttcatctatcgagttggatttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacagaaactgcaagatgctgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccatctaaaaga
aaaattcatatcagtgaactcatgttagataagtgtccgttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataagtcccaaatcagatgaa
tgggtaagcacagacttgtctcagagcgaattgagggatggtcagctaaaacaacgaaga
aacatggaagaggtcagctgcttctcacataccagtgttcagccctgtgtcataaccagt
aacaattcttcgggtagaggtggtcctgggactgactctatagtgaacctggcttcaaat
aacagcatagaagatagtgacatggattcagatgatgaaattataacactttgcacaagt
tcccggaaaagaaacaaacccaaatgggaaattgatgaagaaatcctgcaactggaaaca
cctcccaagtaccatactcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataataatccatgttactggggtgttatggataaatatgcagctgaagctctacta
gaaggaaaaccagaaggcacctttttactgcgagattcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcacgctagaattgaacagtggaatcac
aactttagctttgatgcacatgatccttgtgtcttccattcgcctgacattactgggctc
ctagagcattataaggacccgagtgcctgtatgttcttcgaaccacttttatccactcct
ttaattcggactttccccttttccctgcagcatatatgcagaacagttatttgtaactgt
acaacttacgatggcattgatgcccttccaattccttcttccatgaaattatatctgaag
gaatatcactataaatcaaaagttagagtactcaggattgatgcaccagaacaacaatgc
tag

KEGG   Bos mutus (wild yak): 102270492
Entry
102270492         CDS       T02919                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102270492 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102270492 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102270492 (SOCS6)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102270492 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 102270492
NCBI-ProteinID: XP_014335328
LinkDB
Position
Un
AA seq 393 aa
MKKISLKTFRKSFNLSKSKEDAEFMVVQQPALASDFGKEESLFGSCYGKEMAGCELHGED
EKGGGKNRAKSESLMGTLKRRLSAKQKAKGKGGAAAGGAADEDTFSSSSAPLVFKDARAP
RPMRSTSLRSHHYSPTPWPLRPTASEETCIRMEVRVKALVHSPGTGPALSPLLPPLQTDP
SQRTFTGLAGPDAHAADSVRCHLNFDPTSAPGVARVYDSVQSSGPLAVTSLTEELKKLAK
QGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFS
FYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSXRLPGSATYPVRLTNPVSRFMQVRSLQY
LCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaagaagatcagccttaagaccttccggaagtctttcaatttgagtaagagcaaagaa
gacgcagaattcatggtcgtacaacagccagcactagccagcgactttggcaaagaggag
tccttgttcgggagctgctacgggaaggagatggccggctgcgagctgcacggcgaggac
gaaaagggcggcggcaagaaccgggccaagagcgagagcctcatgggcacgctgaagagg
cggctgagcgccaagcagaaggccaagggcaagggtggcgcggcggcggggggcgcggca
gatgaggataccttctcgtcgtcatcggcgccgctggtgttcaaggatgcacgggcgccg
cggcccatgcgctccacgtcactgcgcagccaccactacagccccacgccctggccgctg
cggcccaccgcctcggaggagacgtgcatccggatggaggtgcgggtcaaggcgctggtg
cactcgcccggcacgggcccggctctctccccgctgctacctccgctgcagaccgatccg
agccaaaggaccttcaccgggctggccggcccggatgcccacgcggccgacagcgtgcgc
tgccacttgaattttgaccccacctcagctcccggggtggccagggtgtacgactcggtg
cagagcagcggccccctggcggtgaccagcctgacggaggagctcaagaagctggccaag
cagggctggtactgggggcccatcacgcgctgggaggcagagggcaagctggccaacgtg
cccgacggctccttcctggtgcgggacagctcagacgaccgctacctgctcagcctgagc
ttccgctcacacggcaagaccctgcacacccggatcgagcactcgaacggccggttcagc
ttctacgagcagccggacgtagaggggcacacgtccatcgtggacctaatcgagcactcc
atcagggactcggagaacggcgccttctgctactccncgcgcctgccgggctccgccacc
tacccggtgcggctcaccaacccggtgtcgcgcttcatgcaggtgcgctcgctgcagtac
ctgtgccgcttcgtcatccgccagtacacccggatagacctgatccagaagctgcccctg
cccaacaaaatgaaggattacctacaggagaagcactactga

KEGG   Bos mutus (wild yak): 102273017
Entry
102273017         CDS       T02919                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04120  Ubiquitin mediated proteolysis
bom04380  Osteoclast differentiation
bom04630  JAK-STAT signaling pathway
bom04668  TNF signaling pathway
bom04910  Insulin signaling pathway
bom04917  Prolactin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04935  Growth hormone synthesis, secretion and action
bom05160  Hepatitis C
bom05164  Influenza A
bom05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102273017 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102273017 (SOCS3)
   04668 TNF signaling pathway
    102273017 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102273017 (SOCS3)
   04920 Adipocytokine signaling pathway
    102273017 (SOCS3)
   04917 Prolactin signaling pathway
    102273017 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    102273017 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102273017 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102273017 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    102273017 (SOCS3)
   04931 Insulin resistance
    102273017 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102273017 (SOCS3)
   05164 Influenza A
    102273017 (SOCS3)
   05168 Herpes simplex virus 1 infection
    102273017 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102273017 (SOCS3)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102273017 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 102273017
NCBI-ProteinID: XP_005910381
UniProt: L8HMX8
LinkDB
Position
Un
AA seq 229 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSTVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPAAGAPSFSQPPAEPSSSPSSEVPEQPPAQPLSGNPPRRAYYIYSGGEKIPL
VLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 690 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttttactggagcaccgtgacgggcggcgaagcgaacttgctgctg
agcgccgagcccgcgggcaccttcctcatccgcgacagctcggaccagcgccactttttc
accctcagcgtcaagacccagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctctctccagagcgacccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcatcactacatgcccgccgccggcgccccctcgttctcccagcccccc
gctgaaccctcctcctcgccctcctcggaggtgcccgagcagccaccggcccagccgctc
tccgggaacccccccaggagagcctattacatctattcggggggcgagaagatccctctg
gtgttgagccggcccctctcctccaacgtggccactctccaacatctctgtcggaagacc
gtcaacggccacctggactcctacgagaaagtcacccagctgcctgggcccattcgggag
ttcctggaccagtacgatgccccgctttag

KEGG   Bos mutus (wild yak): 102280213
Entry
102280213         CDS       T02919                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102280213 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102280213 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102280213 (SOCS7)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     102280213 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 102280213
NCBI-ProteinID: XP_005911903
UniProt: L8IE39
LinkDB
Position
Un
AA seq 464 aa
LVLEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQTPGPELPPVPFPMQDLVPPGR
LSRGEQPQQPPPPPPPPGPLRPLAGLSRKGSLKIRLSRLFRTKSCNGGSGGGDGAGKRPS
GELAASAASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQR
GLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPR
IAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKP
DGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRA
IMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDL
PLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVLEPST
NT seq 1395 nt   +upstreamnt  +downstreamnt
ctggtcctggagggcttggagtcggaggcagagagcctggagactaacagctgctcggaa
gaggagctcagcagcccgggccgcggaggaggagggggcggccggcttctactgcagacc
cccggccctgaattacccccggtgcccttcccgatgcaggacttggtccctcccgggcgc
ttgagtcgaggggagcagccgcagcagcctcccccgccgccgccgcctcctgggcccctc
cggccactcgccggcctttctcggaagggctccctcaaaatccgcctcagtcgcctcttc
cgcacgaagagctgcaacggtggctctggcggtggggatggggccggcaagaggccttct
ggagagctggctgcttcagctgcgagcctgacagacatgggcggctctgcgggccgggag
ctggacgcggggaggaaacccaggttgacaagaactcaaagtgccttttctccagtctcc
ttcagcccgctgttcacaggtgaaacagtgtctcttgtggacgtggacatctctcagcgg
ggcctgacctctccacaccctccaactccccctcctcctccaagaagaagcctcagcctc
ctagatgatatcagtgggacgctgcctacatctgtccttgtggctccgatggggtcttcc
ctgcagtctttccccttacctccgcctcctccaccccatgccccagatgcatttccccgg
atagctcccatccgagcagctgaatctctgcacagccagcccccgcagcacctccagtgt
cccctctaccggcctgactcgagcagctttgcggctagccttcgagagctggagaagtgt
ggttggtattgggggccaatgaattgggaagatgcagagatgaagctgaaaggcaagcct
gatggttcttttctggtacgagacagctccgatcctcgttatatcctgagcctcagtttc
cgatcacagggtatcactcaccacaccagaatggagcactacagaggaaccttcagcctg
tggtgtcatcccaagtttgaggatcgctgtcaatcagtggtggagttcattaagagggcc
atcatgcactccaagaatgggaagtttctctatttcttgagatccagggttccaggactg
ccaccaactccagtccagttgctctatccagtgtcccgattcagcaatgtcaaatccctc
cagcacctttgccgattccgaatccgacagctcgtccggatcgatcacatcccggatctc
ccactgcctaagcctctgatctcttatatccgaaagttctactactatgatcctcaggaa
gaggtatacctgtctctaaaggaagcgcagctcatttccaaacagaagcaagaggtgttg
gaaccctccacgtag

DBGET integrated database retrieval system