KEGG   Bos mutus (wild yak): 102266275
Entry
102266275         CDS       T02919                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adaptor molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102266275 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102266275 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102266275 (STAM2)
Membrane trafficking [BR:bom04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    102266275 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM ENTH GAT SH3_10
Other DBs
NCBI-GeneID: 102266275
NCBI-ProteinID: XP_005894840
UniProt: A0A6B0RD71
LinkDB
Position
Un
AA seq 526 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPSGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIQSNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTCNLNIESEAAAVDKLNIIDDEEEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLMNEAPVYAVYSKIHHPAHYPTSSAGVPIQTYPVQPHGGNYMGQSIHQVTVAQSYSL
GPDQIGPLRSLPPTVNSSVTTQPAQTPYLSTGQDTISSPTYMNQNSNLQSAPGAAAYTQQ
MGMSVDMSSYQNATSNLPQLAGFPVAVPAHSVAQQQTNYHQQQPLL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcctctgttcaccgccaaccctttcgagcaagatgtggaaaaggctacaaatgagtac
aacactacagaagattggagtcttattatggacatatgtgacaaagttggaagcactcct
aacggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaagttcctcat
gttgctctgcaggcattaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtgtgttcccgtgattttgcaacagaagtacgtgctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactgaaatctttaatggtagaatggtcagaagaattt
cagaaggaccctcagtttagtctaatatctgcaactattaaatctatgaaagaagaagga
attacttttcctccatcaggttctcagactgtctcagctgctgccaaaaacggtacatca
tcgaacaaaaacaaagaagatgaagatatagctaaagctattgaattatcattgcaagag
cagaagcagcagcacacagaaacaaaatccttatatccatctgcagaaattcagtcaaat
aataaagttgcaaggaaagtgagagctttatatgattttgaagctgttgaggacaatgaa
ctcacttttaaacatggtgaaattattattgttttggatgacagtgatgctaattggtgg
aaaggagaaaatcacagaggaattggactcttcccatctaattttgtaacatgtaattta
aacatagaatcagaggcagcagctgtggacaaattgaatataattgatgatgaggaggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtactgcagagtatagatccaacagattcaaaaccagattctcaagacctcttg
gacttagaagatatctgccaacagatgggtccaatgatagatgaaaaacttgaagagatt
gataggaagcattcagaattgtctgaattgaatgtaaaagtcttagaagctctggaactt
tataataagttgatgaatgaagcgccagtatatgcagtctattcaaagatccaccatcca
gcacattacccaacttcatcagctggagttccaattcagacatacccagttcaaccacat
ggtggaaactatatgggtcaaagtattcaccaagtcactgttgcccaaagctacagccta
ggaccagatcagattggtccactgagatctctgcctccaactgtgaattcctcagtgaca
acacagcctgctcaaactccgtacttaagcactggacaagacactatttccagtcctact
tacatgaaccagaactctaaccttcaatcagctcctggtgcagctgcttacacacagcag
atggggatgtctgtggatatgtcatcttaccagaacgctacttccaacttgccgcagttg
gcaggctttccggtggcagttccagctcattcagttgcacagcagcaaacaaattaccat
caacagcagcctctcctttaa

KEGG   Bos mutus (wild yak): 102283569
Entry
102283569         CDS       T02919                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adaptor molecule
  KO
K04705  signal transducing adaptor molecule
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102283569 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102283569 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102283569 (STAM)
Membrane trafficking [BR:bom04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    102283569 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 102283569
NCBI-ProteinID: XP_005891981
LinkDB
Position
Un
AA seq 534 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTAANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGMGLFPSNFVTADLTVEPEMIKTEKKTVQFSDEVQVETIEPEPEPA
YIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYIQSSGVSGSQVYPPQSGAYLVAGSAQM
SHLQSYSLPPEQLSSLSQGAVPPSANPALPTQQAQASYPSTMVSSVPGSTYPSQASVYSP
PPAATAAPDVTIYQNTGTSLSQVPNYTLPSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgcctctgtttgccaccaatcccttcgatcaggatgtcgagaaagcaaccagtgagatg
aatactgctgaggattggggcctcattttggatatttgtgataaagtcggtcagtctcgc
actggacctaaagattgtcttcggtctattatgaggagggtaaaccataaagatcctcat
gtggctatgcaggctctcactcttctaggagcatgtgtatcaaactgtggcaaaattttt
cacttagaagtatgttcgagagattttgctagtgaagtaagcaacgtattaaacaagggt
catcctaaagtatgtgaaaaattgaaggctcttatggttgaatggacggatgaattcaag
aatgatccacagctcagtctgatatcagcaatgattaagaacctgaaagaacagggtgtt
acatttcccgctattggctctcaggctgcagaacaagcgaaagcaagcccagctctggta
gccaaggatcctggtactgcggctaacaaaaaagaagaggaagatttagcgaaagccatt
gagttgtccctgaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccaacctcttaactaaccatcaacatgaaggccggaaagttcgtgctatatacgac
tttgaagctgctgaagataatgaactgacttttaaagctggagaaattattacagttctt
gatgacagtgaccccaactggtggaaaggggaaacccatcaaggcatggggctcttccct
tcaaattttgtgactgcagatctcactgttgagcctgaaatgattaaaacagagaagaag
acggtacaatttagtgatgaagttcaggtagaaacgatagaaccagagccagaaccagcc
tacattgatgaggataaaatggaccagttgctacagatgttgcaaagtacagatcccagt
gatgatcaaccagatcttccagagttacttcatcttgaagcaatgtgtcaccagatgggg
cctctcattgatgagaagctggaggatattgatagaaaacattcagaactctcagaactg
aatgtgaaagtgatggaagccctgtccttgtataccaagttaatgaatgaagaccccatg
tattccatgtatgcaaaattacagaatcagcagtattatattcagtcatctggagtttct
ggttctcaggtgtaccctcctcagagtggtgcttacctggtcgcagggagcgcccagatg
agccacctgcagagctacagcctacccccagagcagctgtcttccctcagccaaggagca
gtgccaccatctgcaaacccagcccttcctactcagcaagcccaggcttcctaccccagc
acaatggtcagctccgtcccgggaagtacgtatcccagccaggcttcggtgtacagtcct
ccccctgctgccacagctgctcccgacgtcaccatctaccagaacacagggaccagcctg
tcccaggtgccgaactatacattaccgtccacactgccccagcctgggggcagccagcag
ccacctcagccgcagcagccatactcccagaaggctctgctatag

DBGET integrated database retrieval system