KEGG   Bos mutus (wild yak): 102266289Help
Entry
102266289         CDS       T02919                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bom01002]
    102266289 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bom03110]
    102266289 (PCSK1)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102266289 (PCSK1)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S8: subtilisin family
   102266289 (PCSK1)
Chaperones and folding catalysts [BR:bom03110]
 Intramolecular chaperones
  Subtilisin family
   102266289 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 102266289
NCBI-ProteinID: XP_005899361
UniProt: L8ICF0
LinkDB All DBs
Position
Un
AA seq 753 aa AA seqDB search
MGRRAWTLQCTAFSLFCAWCAMNSVKAKRQFVNEWAAEIPGGPEAASAIAQELGYDLLGQ
IGSLENHYLFKHRNHPRRSRRSALHITKRLSDDDRVIWAEQQYEKERSKRSVLRDSALDL
FNDPMWNQQWYLQDTRMTATLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPSTWSSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRIADMSGRMQNEGRIVTWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKVVDSGEEQPTQEGLDENAQASQSPSGSGVGGRRDELAE
GAPSEAMLRLLQSAFSKNSPSKQSPKKPPSAKPNIPYENFYEALERLNKPSQLKDSEDSL
YNDYVDGFYNTKPYKHRDDRLLQALVDLLREEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaagagcctggactctgcagtgtactgctttctctctcttttgcgcttggtgt
gcaatgaacagtgtaaaagcgaagaggcagtttgtgaatgaatgggcggcggagatcccc
gggggacctgaggcagcctcggcgatagcccaggagctaggctatgatcttttgggtcag
attggatcacttgaaaatcactacttattcaaacacagaaaccatcctcggaggtctcga
aggagtgcccttcacatcactaagagattgtctgatgatgatcgtgtgatatgggcggaa
caacagtatgaaaaagaaagaagtaaacgttcagttctaagagactcagcactagatctc
ttcaatgatccgatgtggaatcagcagtggtacttgcaagatacaaggatgactgcaacc
ctgcccaagctggatctccacgtgatacctgtttggcaaaaaggcatcacaggcaaaggt
gttgttatcactgtattggatgatggcttggagtggaatcacacagacatctatgccaac
tatgatccggaggccagctatgattttaacgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaaacatggaaccagatgtgcaggagaaattgcgatgcaagca
aataatcacaagtgtggggtcggagttgcatacaattccaaagttggaggcataagaatg
ctagacggcattgtgaccgatgctattgaagccagctcaattggatttaatcctgggcat
gtggatatttacagcgcaagctggggccctaacgatgatgggaaaactgtggaggggcct
ggtcgactggcccagaaggcttttgaatatggtgtcaaacagggcagacaaggaaagggc
tctatcttcgtctgggcctccgggaacggggggcgtcagggagacaactgtgactgcgac
gggtacacggacagcatctataccatctccatcagcagtgcctcgcagcaaggcctatcc
ccctggtacgcagagaagtgctcctccacgctggccacctcgtacagcagtggggactac
accgaccagcgaatcacgagcgctgacctgcacaatgactgcacggagacccatacgggc
acctcagcctctgcacccctggccgctggcatcttcgctctagccctggaagcaaatcca
aatctcacctggcgagatatgcagcacttggttgtatggacctctgagtatgacccactg
gccaataaccctggatggaaaaagaacggagcaggcttgatggtgaacagtcgatttgga
ttcgggctgctaaatgccaaagctctggtggatttggctgatcccagcacctggagcagt
gtgcctgagaagaaggaatgtgttgtcaaggacaatgactttgagcccagagccctgaaa
gctaatggagaagtcatcatagaaattccaacaagagcttgtgaaggtcaagaaaatgct
atcaagtcactggaacatgtgcaatttgaagcaacaattgaatattcccgcagaggagac
cttcatgtcaccctcacttcggccgctggaaccagcaccgtactgttggctgaaagagag
cgggacacctctcccaatggctttaagaactgggacttcatgtctgttcacacgtgggga
gagaaccccataggcacttggactttgcgaattgcagacatgtctggaagaatgcaaaac
gaaggaagaattgtgacctggaagctgatcctgcacgggacctcttcccagccagagcac
atgaaacagccccgggtgtacacgtcttacaacaccgtgcagaatgaccgaagaggcgtg
gaaaaggtggtggactctggggaggagcagcctacacaagagggcctggatgagaacgct
caggcatcccaaagccccagtggcagtggagtcgggggcagaagggatgagctggcagag
ggcgccccttctgaggccatgctgagactcctgcagagcgctttcagcaaaaactcaccc
tcaaagcaatcaccaaagaagcccccaagcgcgaagcccaacatcccttatgaaaacttc
tatgaagccctggaaaggctgaacaaaccctcccagcttaaagactctgaggacagtctg
tataacgactatgtcgatggcttctacaacacgaaaccttacaagcacagggacgaccgg
ctgctccaagctctggtggaccttctgagggaggaaaactaa

DBGET integrated database retrieval system