KEGG   Bos mutus (wild yak): 102266544
Entry
102266544         CDS       T02919                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
bom  Bos mutus (wild yak)
Pathway
bom01524  Platinum drug resistance
bom04141  Protein processing in endoplasmic reticulum
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05160  Hepatitis C
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05203  Viral carcinogenesis
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05216  Thyroid cancer
bom05217  Basal cell carcinoma
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102266544 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102266544 (BAK1)
   04215 Apoptosis - multiple species
    102266544 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102266544 (BAK1)
   05202 Transcriptional misregulation in cancer
    102266544 (BAK1)
   05206 MicroRNAs in cancer
    102266544 (BAK1)
   05203 Viral carcinogenesis
    102266544 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102266544 (BAK1)
   05212 Pancreatic cancer
    102266544 (BAK1)
   05225 Hepatocellular carcinoma
    102266544 (BAK1)
   05226 Gastric cancer
    102266544 (BAK1)
   05214 Glioma
    102266544 (BAK1)
   05216 Thyroid cancer
    102266544 (BAK1)
   05220 Chronic myeloid leukemia
    102266544 (BAK1)
   05217 Basal cell carcinoma
    102266544 (BAK1)
   05218 Melanoma
    102266544 (BAK1)
   05213 Endometrial cancer
    102266544 (BAK1)
   05224 Breast cancer
    102266544 (BAK1)
   05222 Small cell lung cancer
    102266544 (BAK1)
   05223 Non-small cell lung cancer
    102266544 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102266544 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102266544 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102266544 (BAK1)
   05160 Hepatitis C
    102266544 (BAK1)
   05164 Influenza A
    102266544 (BAK1)
   05162 Measles
    102266544 (BAK1)
   05168 Herpes simplex virus 1 infection
    102266544 (BAK1)
   05163 Human cytomegalovirus infection
    102266544 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102266544 (BAK1)
   05169 Epstein-Barr virus infection
    102266544 (BAK1)
   05165 Human papillomavirus infection
    102266544 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102266544 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bom03029]
    102266544 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bom02000]
    102266544 (BAK1)
Mitochondrial biogenesis [BR:bom03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102266544 (BAK1)
Transporters [BR:bom02000]
 Other transporters
  Pores ion channels [TC:1]
   102266544 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102266544
NCBI-ProteinID: XP_005891467
LinkDB
Position
Un
AA seq 211 aa
MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRXXQEQEAEGAAAPTDPEM
VTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAA
LDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttccggacaaggcccaggtccccccgggcaggactgcgacgagcctgacccctcc
tccacctcagaggagcaggtagcccgggacaccgaggaggtcttccgcagctacgtcttt
taccgnnnnnngcaggaacaggaggccgagggggcggctgcgcctactgacccagagatg
gtcaccttgcacccagaacctagcagcaccatggggcaggtgggccgccagctcgccgtc
atcggggacgacatcaaccggcgctatgatgcggagttccaggccatgctgcagcacctg
cagccaacagcagacaacgcctatgagtacttcaccaagatcgcgtccagcctgtttgag
agcggtatcaactggggccgcgtggtggctctgctgggctttggctaccgcctggccctc
cacgtctaccagcgcggcctgaccggcttcctgggccaggtgacccgcttcgtggccgac
ttcatgctgcgtcgctccatcgcccggtggatcgcgcagaggggtggctgggtggcagcc
ctggacttggggaacggccccatcaagagcgtagccatcgttctggctgtggttttgttg
ggccagtttgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system