KEGG   Bos mutus (wild yak): 102266749
Entry
102266749         CDS       T02919                                 

Gene name
PPP3CA
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04720  Long-term potentiation
bom04724  Glutamatergic synapse
bom04728  Dopaminergic synapse
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05031  Amphetamine addiction
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102266749 (PPP3CA)
   04310 Wnt signaling pathway
    102266749 (PPP3CA)
   04370 VEGF signaling pathway
    102266749 (PPP3CA)
   04020 Calcium signaling pathway
    102266749 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    102266749 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102266749 (PPP3CA)
   04218 Cellular senescence
    102266749 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102266749 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    102266749 (PPP3CA)
   04660 T cell receptor signaling pathway
    102266749 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    102266749 (PPP3CA)
   04659 Th17 cell differentiation
    102266749 (PPP3CA)
   04662 B cell receptor signaling pathway
    102266749 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102266749 (PPP3CA)
   04921 Oxytocin signaling pathway
    102266749 (PPP3CA)
   04924 Renin secretion
    102266749 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102266749 (PPP3CA)
   04728 Dopaminergic synapse
    102266749 (PPP3CA)
   04720 Long-term potentiation
    102266749 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102266749 (PPP3CA)
   04380 Osteoclast differentiation
    102266749 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102266749 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102266749 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    102266749 (PPP3CA)
   05020 Prion disease
    102266749 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    102266749 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102266749 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102266749 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102266749 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    102266749 (PPP3CA)
   05163 Human cytomegalovirus infection
    102266749 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102266749 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102266749 (PPP3CA)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102266749 (PPP3CA)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102266749 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 102266749
NCBI-ProteinID: XP_005897752
LinkDB
Position
Un
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEETV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacggcaaaagaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctcgaagagactgtc
gcattgagaataataacagagggggcttcaattcttcgacaggaaaaaaacttgctggat
attgatgctccagtcacagtttgtggggacatccatggacaattctttgacttgatgaaa
ctctttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggctttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgatgcctgcatggat
gcctttgactgcctgcccctggctgccctgatgaaccagcagttcctgtgtgtacacggc
ggtttgtctccagagataaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagacccgctggaagattttgga
aacgagaagactcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttacccggctgtatgtgaattcttgcagcacaataacttgttatctatcctccgagct
catgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttcccc
tctctcattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgtcatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgttttcacctggtccctgccgtttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagacgatgaactagggtcagaa
gaagatggatttgatggagcaacggctgcagccaggaaggaggtgataagaaataagatc
cgagccatcggcaagatggccagagtgttctcggttctcagagaagagagtgagagtgtg
ctgacgctgaaaggcctgacgcccacaggcatgctccccagcggcgtgctttctggaggg
aaacaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaac
gagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Bos mutus (wild yak): 102272271
Entry
102272271         CDS       T02919                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04720  Long-term potentiation
bom04724  Glutamatergic synapse
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05031  Amphetamine addiction
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102272271 (PPP3R1)
   04310 Wnt signaling pathway
    102272271 (PPP3R1)
   04370 VEGF signaling pathway
    102272271 (PPP3R1)
   04020 Calcium signaling pathway
    102272271 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    102272271 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102272271 (PPP3R1)
   04218 Cellular senescence
    102272271 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102272271 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    102272271 (PPP3R1)
   04660 T cell receptor signaling pathway
    102272271 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    102272271 (PPP3R1)
   04659 Th17 cell differentiation
    102272271 (PPP3R1)
   04662 B cell receptor signaling pathway
    102272271 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102272271 (PPP3R1)
   04921 Oxytocin signaling pathway
    102272271 (PPP3R1)
   04924 Renin secretion
    102272271 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102272271 (PPP3R1)
   04720 Long-term potentiation
    102272271 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102272271 (PPP3R1)
   04380 Osteoclast differentiation
    102272271 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102272271 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102272271 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    102272271 (PPP3R1)
   05020 Prion disease
    102272271 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    102272271 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    102272271 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102272271 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272271 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    102272271 (PPP3R1)
   05163 Human cytomegalovirus infection
    102272271 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102272271 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102272271 (PPP3R1)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102272271 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 102272271
NCBI-ProteinID: XP_005893636
LinkDB
Position
Un
AA seq 160 aa
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgctcacactttgatgcagatgaaattaaaaggctaggaaagagatttaagaagctc
gatttggacaattctggttctttgagtgtggaagagttcatgtctctacctgagttacaa
cagaatcccttagtacagcgagtaatagatatattcgacacagatgggaatggagaagta
gactttaaagagttcattgagggagtctctcagttcagtgtcaaaggagataaggaacag
aagttgaggtttgctttccgtatctatgacatggataaagacggctatatttccaatggg
gaactcttccaggtgctaaagatgatggtggggaacaatctgaaagatacacagttacag
caaattgtagacaaaaccataataaatgcagataaggatggggatggaagaatatccttt
gaagaattctgtgctgttgtaggcggcctagatatccacaaaaagatggtggtagacgtg
tga

KEGG   Bos mutus (wild yak): 102275863
Entry
102275863         CDS       T02919                                 

Gene name
PPP3CB
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04720  Long-term potentiation
bom04724  Glutamatergic synapse
bom04728  Dopaminergic synapse
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05031  Amphetamine addiction
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102275863 (PPP3CB)
   04310 Wnt signaling pathway
    102275863 (PPP3CB)
   04370 VEGF signaling pathway
    102275863 (PPP3CB)
   04020 Calcium signaling pathway
    102275863 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    102275863 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102275863 (PPP3CB)
   04218 Cellular senescence
    102275863 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102275863 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    102275863 (PPP3CB)
   04660 T cell receptor signaling pathway
    102275863 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    102275863 (PPP3CB)
   04659 Th17 cell differentiation
    102275863 (PPP3CB)
   04662 B cell receptor signaling pathway
    102275863 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102275863 (PPP3CB)
   04921 Oxytocin signaling pathway
    102275863 (PPP3CB)
   04924 Renin secretion
    102275863 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102275863 (PPP3CB)
   04728 Dopaminergic synapse
    102275863 (PPP3CB)
   04720 Long-term potentiation
    102275863 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102275863 (PPP3CB)
   04380 Osteoclast differentiation
    102275863 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102275863 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102275863 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    102275863 (PPP3CB)
   05020 Prion disease
    102275863 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    102275863 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102275863 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102275863 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275863 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    102275863 (PPP3CB)
   05163 Human cytomegalovirus infection
    102275863 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275863 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102275863 (PPP3CB)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102275863 (PPP3CB)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102275863 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 102275863
NCBI-ProteinID: XP_005910138
LinkDB
Position
Un
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQDCKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHGAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggacgggatacccagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggtgctgccattcttcggagagagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctgtatccaagtacattatttcttctgagaggcaaccatgaatgcagacacctt
actgaatattttacctttaagcaggattgtaaaattaaatattcagaaagagtctatgaa
gcttgtatggaagcttttgatagcttgcctcttgctgcacttttaaaccaacaatttctt
tgtgttcatggtggactttcaccagaaatacacacactggatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtccgatccttct
gaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccacatccttattggttgcccaattttatggatgttttcacatggtctttaccgttt
gttggagaaaaagtgacggaaatgttggtaaacgttctgagtatttgctctgatgatgaa
cttatgactgaaggcgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaacaaaattcgagcaattggcaagatggcaagggtcttctctgttctcagggag
gagagtgaaagtgtgctgacactcaagggcctgactcccacagggatgttgcctagtgga
gtgttggctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaagatggtttc
aattctctgaacaccgcacatgccactgagaaccacgggactggcaaccatggtgcccag
tga

KEGG   Bos mutus (wild yak): 102277736
Entry
102277736         CDS       T02919                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04720  Long-term potentiation
bom04724  Glutamatergic synapse
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05031  Amphetamine addiction
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102277736 (PPP3R2)
   04310 Wnt signaling pathway
    102277736 (PPP3R2)
   04370 VEGF signaling pathway
    102277736 (PPP3R2)
   04020 Calcium signaling pathway
    102277736 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    102277736 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102277736 (PPP3R2)
   04218 Cellular senescence
    102277736 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102277736 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    102277736 (PPP3R2)
   04660 T cell receptor signaling pathway
    102277736 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    102277736 (PPP3R2)
   04659 Th17 cell differentiation
    102277736 (PPP3R2)
   04662 B cell receptor signaling pathway
    102277736 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102277736 (PPP3R2)
   04921 Oxytocin signaling pathway
    102277736 (PPP3R2)
   04924 Renin secretion
    102277736 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102277736 (PPP3R2)
   04720 Long-term potentiation
    102277736 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102277736 (PPP3R2)
   04380 Osteoclast differentiation
    102277736 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102277736 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102277736 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    102277736 (PPP3R2)
   05020 Prion disease
    102277736 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    102277736 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    102277736 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102277736 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102277736 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    102277736 (PPP3R2)
   05163 Human cytomegalovirus infection
    102277736 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102277736 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102277736 (PPP3R2)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102277736 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 102277736
NCBI-ProteinID: XP_005908486
UniProt: A0A6B0S294
LinkDB
Position
Un
AA seq 170 aa
MGNEASYPAEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKEFTSMPELQENPLVQRVID
VFDTDGDGQVDFREFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEVHKHLVTIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagttacccggcggagatatgctcgcacttcgacgaagatgaaatt
aaaaggctgcgcaagcgttttaagaagctggacttggacagttccagcgctctgagcgtc
aaagagttcacgtccatgccggagctgcaggagaaccctctggtgcagcgggtgatcgac
gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc
cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac
atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggta
ggcgacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcctcctg
gacaaagacggggacgggaaaatctccttccaagaattcagtgctgtggtcagaagcctg
gaggtccacaagcacttggtgaccattgtgtga

KEGG   Bos mutus (wild yak): 102286752
Entry
102286752         CDS       T02919                                 

Gene name
PPP3CC
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04020  Calcium signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04114  Oocyte meiosis
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04625  C-type lectin receptor signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04720  Long-term potentiation
bom04724  Glutamatergic synapse
bom04728  Dopaminergic synapse
bom04921  Oxytocin signaling pathway
bom04922  Glucagon signaling pathway
bom04924  Renin secretion
bom05010  Alzheimer disease
bom05014  Amyotrophic lateral sclerosis
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05031  Amphetamine addiction
bom05152  Tuberculosis
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05170  Human immunodeficiency virus 1 infection
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102286752 (PPP3CC)
   04310 Wnt signaling pathway
    102286752 (PPP3CC)
   04370 VEGF signaling pathway
    102286752 (PPP3CC)
   04020 Calcium signaling pathway
    102286752 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    102286752 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102286752 (PPP3CC)
   04218 Cellular senescence
    102286752 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102286752 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    102286752 (PPP3CC)
   04660 T cell receptor signaling pathway
    102286752 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    102286752 (PPP3CC)
   04659 Th17 cell differentiation
    102286752 (PPP3CC)
   04662 B cell receptor signaling pathway
    102286752 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102286752 (PPP3CC)
   04921 Oxytocin signaling pathway
    102286752 (PPP3CC)
   04924 Renin secretion
    102286752 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    102286752 (PPP3CC)
   04728 Dopaminergic synapse
    102286752 (PPP3CC)
   04720 Long-term potentiation
    102286752 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    102286752 (PPP3CC)
   04380 Osteoclast differentiation
    102286752 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102286752 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102286752 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    102286752 (PPP3CC)
   05020 Prion disease
    102286752 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    102286752 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    102286752 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102286752 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286752 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    102286752 (PPP3CC)
   05163 Human cytomegalovirus infection
    102286752 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286752 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102286752 (PPP3CC)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102286752 (PPP3CC)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102286752 (PPP3CC)
SSDB
Motif
Pfam: Metallophos PTEN_C2 DUF5378
Other DBs
NCBI-GeneID: 102286752
NCBI-ProteinID: XP_005895380
LinkDB
Position
Un
AA seq 512 aa
MSGRNLHLSTTERVIKAVPFPPTQRLSLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPVTVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQMTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDELEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKGL
TPTGTLPLGVLSGGKQTIETAIRGFSLQHRIRSFEEARGLDRINERMPPRKDSQYFDGPV
KLVQANAAHRSDKGRRASNDSEPCGGTGGSKT
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtccgggaggaacctccacctctccaccaccgaacgcgtcatcaaagctgtccccttt
cctccgacccagcggctttctttgaaggaagtatttgagaatgggaaacctaaaattgat
gttttgaaaaaccatttggtgaaggaagggcgactggaagaggaagtagccttaaaaata
atcaatgatggggctgccatactgagacaagagaagactatgatagaagtagatgctcca
gtcacggtatgtggtgacattcatggacaattctttgacctgatgaagttgtttgaagtt
ggaggatcacctagtaatacacgctacctcttcctgggtgactacgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagatcaatcatcccaaaacattg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagaatattttaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtacgatgcgtgtatggaaacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctgtgtgtacatggaggaatgtcacct
gaaattacttgtttagatgacattcggaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccctccgaggattatggcaatgaaaagacc
ttggaacactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtttgtgaatttctgcagaacaataatttgctctcaataatcagagcccatgaagcccaa
gatgccgggtatcgaatgtacaggaagagccaaatgacgggctttccatcgctcattaca
attttctctgcacccaattacctagatgtctataacaataaagctgctgtgttaaaatat
gaaaacaacgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacgtggtctttgccttttgtcggggaaaaagttacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttctgatgatgaacttgaa
ggaggcactacagttcgcaaggagatcatcaagaataaaatcagagctattgggaagatg
gcacgggtcttttcaattcttcgggaagagagtgagagcgtgctaactctcaagggcctg
actcctacagggacactgcctttgggtgtcctctcaggaggaaagcagactattgagaca
gccatcagagggttttcgcttcagcacaggatccgaagttttgaagaagcccgaggtctc
gaccggattaatgagcggatgccaccccgcaaagatagccagtactttgatgggccggtg
aaactggtccaagccaacgctgcacacaggagcgacaagggaagaagagccagtaatgac
tcagagccctgcggtggcactggtggctccaagacttaa

DBGET integrated database retrieval system