KEGG   Bos mutus (wild yak): 102266922
Entry
102266922         CDS       T02919                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05020  Prion disease
bom05100  Bacterial invasion of epithelial cells
bom05135  Yersinia infection
bom05142  Chagas disease
bom05146  Amoebiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102266922 (PIK3R1)
   04014 Ras signaling pathway
    102266922 (PIK3R1)
   04015 Rap1 signaling pathway
    102266922 (PIK3R1)
   04370 VEGF signaling pathway
    102266922 (PIK3R1)
   04630 JAK-STAT signaling pathway
    102266922 (PIK3R1)
   04668 TNF signaling pathway
    102266922 (PIK3R1)
   04066 HIF-1 signaling pathway
    102266922 (PIK3R1)
   04068 FoxO signaling pathway
    102266922 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    102266922 (PIK3R1)
   04072 Phospholipase D signaling pathway
    102266922 (PIK3R1)
   04071 Sphingolipid signaling pathway
    102266922 (PIK3R1)
   04024 cAMP signaling pathway
    102266922 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    102266922 (PIK3R1)
   04152 AMPK signaling pathway
    102266922 (PIK3R1)
   04150 mTOR signaling pathway
    102266922 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102266922 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    102266922 (PIK3R1)
   04218 Cellular senescence
    102266922 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102266922 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102266922 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102266922 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102266922 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    102266922 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    102266922 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    102266922 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    102266922 (PIK3R1)
   04660 T cell receptor signaling pathway
    102266922 (PIK3R1)
   04662 B cell receptor signaling pathway
    102266922 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    102266922 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    102266922 (PIK3R1)
   04670 Leukocyte transendothelial migration
    102266922 (PIK3R1)
   04062 Chemokine signaling pathway
    102266922 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102266922 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    102266922 (PIK3R1)
   04929 GnRH secretion
    102266922 (PIK3R1)
   04915 Estrogen signaling pathway
    102266922 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    102266922 (PIK3R1)
   04917 Prolactin signaling pathway
    102266922 (PIK3R1)
   04926 Relaxin signaling pathway
    102266922 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    102266922 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    102266922 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102266922 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102266922 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    102266922 (PIK3R1)
   04722 Neurotrophin signaling pathway
    102266922 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102266922 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102266922 (PIK3R1)
   04380 Osteoclast differentiation
    102266922 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    102266922 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    102266922 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102266922 (PIK3R1)
   05206 MicroRNAs in cancer
    102266922 (PIK3R1)
   05205 Proteoglycans in cancer
    102266922 (PIK3R1)
   05203 Viral carcinogenesis
    102266922 (PIK3R1)
   05230 Central carbon metabolism in cancer
    102266922 (PIK3R1)
   05231 Choline metabolism in cancer
    102266922 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102266922 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102266922 (PIK3R1)
   05212 Pancreatic cancer
    102266922 (PIK3R1)
   05225 Hepatocellular carcinoma
    102266922 (PIK3R1)
   05226 Gastric cancer
    102266922 (PIK3R1)
   05214 Glioma
    102266922 (PIK3R1)
   05221 Acute myeloid leukemia
    102266922 (PIK3R1)
   05220 Chronic myeloid leukemia
    102266922 (PIK3R1)
   05218 Melanoma
    102266922 (PIK3R1)
   05211 Renal cell carcinoma
    102266922 (PIK3R1)
   05215 Prostate cancer
    102266922 (PIK3R1)
   05213 Endometrial cancer
    102266922 (PIK3R1)
   05224 Breast cancer
    102266922 (PIK3R1)
   05222 Small cell lung cancer
    102266922 (PIK3R1)
   05223 Non-small cell lung cancer
    102266922 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102266922 (PIK3R1)
   05017 Spinocerebellar ataxia
    102266922 (PIK3R1)
   05020 Prion disease
    102266922 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102266922 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102266922 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    102266922 (PIK3R1)
   04931 Insulin resistance
    102266922 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102266922 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102266922 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    102266922 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102266922 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    102266922 (PIK3R1)
   05161 Hepatitis B
    102266922 (PIK3R1)
   05160 Hepatitis C
    102266922 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    102266922 (PIK3R1)
   05164 Influenza A
    102266922 (PIK3R1)
   05162 Measles
    102266922 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    102266922 (PIK3R1)
   05163 Human cytomegalovirus infection
    102266922 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102266922 (PIK3R1)
   05169 Epstein-Barr virus infection
    102266922 (PIK3R1)
   05165 Human papillomavirus infection
    102266922 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102266922 (PIK3R1)
   05142 Chagas disease
    102266922 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102266922 (PIK3R1)
   01524 Platinum drug resistance
    102266922 (PIK3R1)
   01522 Endocrine resistance
    102266922 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102266922 (PIK3R1)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102266922 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 DUF4201 AAA_13 Lant_dehydr_C PI_PP_I
Other DBs
NCBI-GeneID: 102266922
NCBI-ProteinID: XP_014332235
LinkDB
Position
Un
AA seq 712 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGPSKTEADSEQQASTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDTASLDLEMFDVH
VLADAFKRYLLDLPNPVIPVAVSSELISLAPEVQGSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIK
IFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQ
AAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVED
DEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVI
NKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccagtaccgggcgctgtacgactataagaaggagcgggaagaa
gacattgacttgcacctgggggacatattgactgtgaacaaagggtccttggtcgctctt
ggattcagtgatggacaggaagccaagcctgaagaaattggctggttaaatggctataat
gagacgacaggggagaggggagactttccgggaacttacgtagaatatattggaaggaaa
aagatctcgcctcccacaccaaagccccggccacctcgaccccttcctgttgccccaggt
ccttcaaaaactgaagcagacagtgagcaacaagcttccactctcccagaccttgcagag
cagttcgcaccccctgacgttgctccaccgcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagccgag
ttacgacagcttcttgattgtgataccgcctccttggacttggagatgttcgatgtgcac
gttttagctgacgccttcaaacgctatctcctggacttaccgaatcctgtcattccggta
gccgtttccagtgaactgatttctttagccccagaagtgcagggttctgaagaatacatc
cagctgttgaagaaactcattaggtcgcccagcatacctcatcagtactggctcacactg
cagtatttgctaaaacatttcttcaagctctctcaaacgtccagcaaaaatcttctgaat
gcaagagtactttctgaactcttcagccctctgcttttcagattcccagcagcaagttct
gagaatactgaacacctcataaaaattatagaaatcttaatctccaccgaatggaatgaa
cgccagcctgcaccagcactgcctcccaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtctttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagacacagctgacgggacctttttggtacgagacgca
tctactaaaatgcacggggattacacgcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaaactg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctcaagaaaaaagtcgggaatatgatagattatatgaagactatacccga
acttcccaggaaatccaaatgaaaagaacagctattgaagcatttaatgaaaccataaaa
atatttgaagaacagtgccaaacccaggagcggtacagcaaagaatacatagaaaagttc
aaacgtgaaggcaacgagacggaaatccaaaggattatgcataattatgaaaagttaaag
tctcgaatcagtgaaattgtcgacagcagaaggagattggaagaggacttgaagaagcag
gcggctgagtatcgtgagattgacaaacgcatgaacagcattaaaccagacctcattcag
ctaagaaagacgagagaccaatacttgatgtggttgactcagaaaggtgttcggcagaag
aaattgaacgagtggctgggcaatgaaaacactgaagaccaatattcgctggtagaagat
gatgaggatttgccccaccacgatgagaagacttggaatgttggaagcagcaaccgaaac
aaagctgaaaacctgttgcgagggaagcgagacggcacttttcttgtccgggaaagcagt
aaacagggctgctacgcctgctctgtggtggtggacggcgaggtcaagcactgcgtcatc
aacaagacggccacgggctacggcttcgccgagccctacaacctgtacagctccctcaag
gagctggtgctccactaccagcacacctctctcgtgcagcacaacgactccctcaacgtc
acactagcctacccggtgtacgcgcagcagaggcgatga

KEGG   Bos mutus (wild yak): 102274461
Entry
102274461         CDS       T02919                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00562  Inositol phosphate metabolism
bom01100  Metabolic pathways
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05020  Prion disease
bom05100  Bacterial invasion of epithelial cells
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05146  Amoebiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102274461 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102274461 (PIK3CD)
   04014 Ras signaling pathway
    102274461 (PIK3CD)
   04015 Rap1 signaling pathway
    102274461 (PIK3CD)
   04370 VEGF signaling pathway
    102274461 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102274461 (PIK3CD)
   04668 TNF signaling pathway
    102274461 (PIK3CD)
   04066 HIF-1 signaling pathway
    102274461 (PIK3CD)
   04068 FoxO signaling pathway
    102274461 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102274461 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102274461 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102274461 (PIK3CD)
   04024 cAMP signaling pathway
    102274461 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102274461 (PIK3CD)
   04152 AMPK signaling pathway
    102274461 (PIK3CD)
   04150 mTOR signaling pathway
    102274461 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102274461 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102274461 (PIK3CD)
   04218 Cellular senescence
    102274461 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102274461 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102274461 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102274461 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102274461 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    102274461 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102274461 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102274461 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102274461 (PIK3CD)
   04660 T cell receptor signaling pathway
    102274461 (PIK3CD)
   04662 B cell receptor signaling pathway
    102274461 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102274461 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102274461 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102274461 (PIK3CD)
   04062 Chemokine signaling pathway
    102274461 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102274461 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102274461 (PIK3CD)
   04929 GnRH secretion
    102274461 (PIK3CD)
   04915 Estrogen signaling pathway
    102274461 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102274461 (PIK3CD)
   04917 Prolactin signaling pathway
    102274461 (PIK3CD)
   04926 Relaxin signaling pathway
    102274461 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102274461 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102274461 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102274461 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102274461 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102274461 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102274461 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102274461 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102274461 (PIK3CD)
   04380 Osteoclast differentiation
    102274461 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102274461 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102274461 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274461 (PIK3CD)
   05206 MicroRNAs in cancer
    102274461 (PIK3CD)
   05205 Proteoglycans in cancer
    102274461 (PIK3CD)
   05203 Viral carcinogenesis
    102274461 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102274461 (PIK3CD)
   05231 Choline metabolism in cancer
    102274461 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102274461 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102274461 (PIK3CD)
   05212 Pancreatic cancer
    102274461 (PIK3CD)
   05225 Hepatocellular carcinoma
    102274461 (PIK3CD)
   05226 Gastric cancer
    102274461 (PIK3CD)
   05214 Glioma
    102274461 (PIK3CD)
   05221 Acute myeloid leukemia
    102274461 (PIK3CD)
   05220 Chronic myeloid leukemia
    102274461 (PIK3CD)
   05218 Melanoma
    102274461 (PIK3CD)
   05211 Renal cell carcinoma
    102274461 (PIK3CD)
   05215 Prostate cancer
    102274461 (PIK3CD)
   05213 Endometrial cancer
    102274461 (PIK3CD)
   05224 Breast cancer
    102274461 (PIK3CD)
   05222 Small cell lung cancer
    102274461 (PIK3CD)
   05223 Non-small cell lung cancer
    102274461 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102274461 (PIK3CD)
   05017 Spinocerebellar ataxia
    102274461 (PIK3CD)
   05020 Prion disease
    102274461 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102274461 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102274461 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102274461 (PIK3CD)
   04931 Insulin resistance
    102274461 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102274461 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102274461 (PIK3CD)
   05135 Yersinia infection
    102274461 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102274461 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102274461 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102274461 (PIK3CD)
   05161 Hepatitis B
    102274461 (PIK3CD)
   05160 Hepatitis C
    102274461 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102274461 (PIK3CD)
   05164 Influenza A
    102274461 (PIK3CD)
   05162 Measles
    102274461 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102274461 (PIK3CD)
   05163 Human cytomegalovirus infection
    102274461 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102274461 (PIK3CD)
   05169 Epstein-Barr virus infection
    102274461 (PIK3CD)
   05165 Human papillomavirus infection
    102274461 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102274461 (PIK3CD)
   05142 Chagas disease
    102274461 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102274461 (PIK3CD)
   01524 Platinum drug resistance
    102274461 (PIK3CD)
   01522 Endocrine resistance
    102274461 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102274461 (PIK3CD)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102274461 (PIK3CD)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102274461 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_C2 PI3K_p85B DOCK-C2 DUF4135
Other DBs
NCBI-GeneID: 102274461
NCBI-ProteinID: XP_005892789
LinkDB
Position
Un
AA seq 1013 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKFHMLSDPEAYVFT
CVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSL
QDPEVNDFRGKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGPGTLRVPNRVLL
VNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGKHEYLY
GSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRTKPPPIPMKKP
SSVSLWSLEQPFYIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSSSEVSVCSEPVW
KQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQ
LKTGEHCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAPHPVYYPSLDKI
LELGRLGEHGRFTEEEQLQLRESLERRGXGRSLEPDAARTPALTARILLQMLYLLCSWPE
LPVLSALELLDFSFPDRHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFK
NLLDRALANRRIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSK
LKALNDVVKVSSQKTTKPQTKELMHLCMRQETYLEALSHLQSPLDPSTLLAEVCVEQCTF
MDSKMKPLWVMYSNEEAGSDGTVGIIFKNGDDLRQDMLTLQMIQLMDILWKQEGLDLRMT
PYGCLSTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRA
IEEFTLSCAGYCVATYVLGIGDRHSDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVP
FILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSC
SKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3042 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
gcagttgatttcttgctccccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcactatcaagaagttccacatgctcagtgaccctgaggcctacgtgttcacc
tgcgtcaaccagacggcggagcagcaggagctggaggacgagcagcggcggctctgcgac
atccagcccttcctgcccgtcctgcggctggtggcccgcgagggtgaccgcgtgaagaag
ctcatcaactcgcagatcagcctgctcatcggcaaaggcctccacgagtttgactccttg
caagacccggaggtgaatgacttccgaggcaagatgcgccagttctgcgaggaggcggct
gcccgcaggcagcagctgggctgggaggcctggctgcagtacagcttccctctgcagttg
gagccctcggcgcggagctgggggccaggcaccctgcgcgtccccaatcgggtcctcctg
gtcaatgtcaagtttgagggcagcgaggagagcttcaccttccaggtatccaccaaggat
gtgcccctggcactgatggcctgtgccctccgaaagaaggccacggtgttccggcagccg
ctggtggagcagcctgaggactacacgctgcaggtgaacggcaagcacgagtacctgtac
ggcagctaccccctctgccagttccagtacatctgcagctgcctgcacagtgggctgacc
ccgcacctgaccatggtgcactcctcctccatcctcgccatgcgggacgagcagagcaac
cccgccccccaagtccagaagccacgcaccaaaccaccccccatccccatgaagaagccc
tcctctgtgtccctctggtccctggagcagcctttctacatcgagctgatccagggcagc
aaagtgaatgccgacgagcggatgaagctggtggtgcaggccgggctcttccatggcaat
gagacgctatgcaagacggtgtccagctcggaggtgagcgtgtgctcggagcccgtgtgg
aagcagcggctggagtttgacatcaacatctgtgacctgccccgcatggcccggctctgc
ttcgcgctttacgctgtgatcgagaaggccaagaaggcccgctccaccaagaagaagtcc
aagaaggcggactgccccattgcctgggccaacctcatgctgtttgactacaaggaccag
ctcaagacgggcgagcactgtctctatatgtggccctctgtcccagacgagaaaggggaa
ctactgaacccctgtgggaccgtgcggagtaaccccaacactgagagtgcagccgccctg
gtcatctttctccctgaggtggcccctcaccctgtatactacccttccctggacaagatc
ctggagctggggcggcttggagagcatggacgcttcacggaggaggagcagctgcagctg
cgggagagcctggagcggcggggnnaggggcggagcctggagccagacgcagcccgcacc
cccgccctgaccgctcgcatcctcctccagatgctctacctgctctgctcctggcctgaa
ctgcccgttctgagcgccctggagttgctagacttcagcttccccgaccgccacgtggga
tccttcgccatcaagtccctgcggaaactaacggacgacgagcttttccagtacctgctg
cagctggtgcaggtgctcaagtacgagtcctacctcgactgcgagctgaccaaattcaaa
aacctgctggaccgggccctggccaatcgcaggatcggccacttcctcttctggcacctc
cgctccgagatgcacgtgccgtcggtggccctgcgcttcggccttatcatggaagcctat
tgccggggcagcactcaccacatgaaagtgctgatgaagcagggggaagcactgagcaaa
ctgaaggccctgaacgacgtcgtcaaagtgagctcccagaagaccaccaagccccagacc
aaggagctgatgcacctgtgcatgcgccaggagacctacctggaggccctctcccacttg
cagtccccactcgaccccagcaccctgctggctgaagtctgcgtggagcagtgcaccttc
atggactccaagatgaaacccctgtgggtcatgtacagcaacgaggaggcaggcagcgac
ggcaccgtgggcatcatctttaagaatggggacgacctccgccaggacatgctgaccctg
cagatgatccagctcatggacattctgtggaagcaggagggcttggacctgaggatgacc
ccctacggctgcctctccactggggaccgcacaggccttatcgaggtggtgcttcactcg
gacaccattgccaacatccagctgaacaagagcaacatggcggccacggctgccttcaat
aaggatgctctgctcaactggctcaagtccaagaaccctggggaggccctggatcgagcc
attgaggagttcaccctctcctgtgctggctactgtgtggctacctatgtgctgggcatt
ggcgatcgtcacagcgacaacatcatgatccgagagaacgggcagctgttccacattgat
ttcggccactttctggggaatttcaagaccaagtttggaatcaaccgtgagcgggtcccg
ttcatcctcacctatgactttgtccacgtgatccagcaagggaagacgaataatagtgag
aagtttgaaaggttccggggctactgtgagagggcctacaccatcctgcggcgccatggg
ctccttttcctccacctctttgccctgatgcgggcggcaggcctgcctgagctcagctgc
tccaaagacatccagtatctcaaggattctctggcattggggaaaacggaggaggaggct
ctgaagcacttccgagtgaagtttaatgaagccctccgggaaagctggaaaaccaaagtg
aattggctggcccacaacgtgtccaaagataacaggcaataa

KEGG   Bos mutus (wild yak): 102274553
Entry
102274553         CDS       T02919                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00562  Inositol phosphate metabolism
bom01100  Metabolic pathways
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05020  Prion disease
bom05100  Bacterial invasion of epithelial cells
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05146  Amoebiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102274553 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102274553 (PIK3CA)
   04014 Ras signaling pathway
    102274553 (PIK3CA)
   04015 Rap1 signaling pathway
    102274553 (PIK3CA)
   04370 VEGF signaling pathway
    102274553 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102274553 (PIK3CA)
   04668 TNF signaling pathway
    102274553 (PIK3CA)
   04066 HIF-1 signaling pathway
    102274553 (PIK3CA)
   04068 FoxO signaling pathway
    102274553 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102274553 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102274553 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102274553 (PIK3CA)
   04024 cAMP signaling pathway
    102274553 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102274553 (PIK3CA)
   04152 AMPK signaling pathway
    102274553 (PIK3CA)
   04150 mTOR signaling pathway
    102274553 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102274553 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102274553 (PIK3CA)
   04218 Cellular senescence
    102274553 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102274553 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102274553 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102274553 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102274553 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    102274553 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102274553 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102274553 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102274553 (PIK3CA)
   04660 T cell receptor signaling pathway
    102274553 (PIK3CA)
   04662 B cell receptor signaling pathway
    102274553 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102274553 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102274553 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102274553 (PIK3CA)
   04062 Chemokine signaling pathway
    102274553 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102274553 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102274553 (PIK3CA)
   04929 GnRH secretion
    102274553 (PIK3CA)
   04915 Estrogen signaling pathway
    102274553 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102274553 (PIK3CA)
   04917 Prolactin signaling pathway
    102274553 (PIK3CA)
   04926 Relaxin signaling pathway
    102274553 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102274553 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102274553 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102274553 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102274553 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102274553 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102274553 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102274553 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102274553 (PIK3CA)
   04380 Osteoclast differentiation
    102274553 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102274553 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102274553 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274553 (PIK3CA)
   05206 MicroRNAs in cancer
    102274553 (PIK3CA)
   05205 Proteoglycans in cancer
    102274553 (PIK3CA)
   05203 Viral carcinogenesis
    102274553 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102274553 (PIK3CA)
   05231 Choline metabolism in cancer
    102274553 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102274553 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102274553 (PIK3CA)
   05212 Pancreatic cancer
    102274553 (PIK3CA)
   05225 Hepatocellular carcinoma
    102274553 (PIK3CA)
   05226 Gastric cancer
    102274553 (PIK3CA)
   05214 Glioma
    102274553 (PIK3CA)
   05221 Acute myeloid leukemia
    102274553 (PIK3CA)
   05220 Chronic myeloid leukemia
    102274553 (PIK3CA)
   05218 Melanoma
    102274553 (PIK3CA)
   05211 Renal cell carcinoma
    102274553 (PIK3CA)
   05215 Prostate cancer
    102274553 (PIK3CA)
   05213 Endometrial cancer
    102274553 (PIK3CA)
   05224 Breast cancer
    102274553 (PIK3CA)
   05222 Small cell lung cancer
    102274553 (PIK3CA)
   05223 Non-small cell lung cancer
    102274553 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102274553 (PIK3CA)
   05017 Spinocerebellar ataxia
    102274553 (PIK3CA)
   05020 Prion disease
    102274553 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102274553 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102274553 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102274553 (PIK3CA)
   04931 Insulin resistance
    102274553 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102274553 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102274553 (PIK3CA)
   05135 Yersinia infection
    102274553 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102274553 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102274553 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102274553 (PIK3CA)
   05161 Hepatitis B
    102274553 (PIK3CA)
   05160 Hepatitis C
    102274553 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102274553 (PIK3CA)
   05164 Influenza A
    102274553 (PIK3CA)
   05162 Measles
    102274553 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102274553 (PIK3CA)
   05163 Human cytomegalovirus infection
    102274553 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102274553 (PIK3CA)
   05169 Epstein-Barr virus infection
    102274553 (PIK3CA)
   05165 Human papillomavirus infection
    102274553 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102274553 (PIK3CA)
   05142 Chagas disease
    102274553 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102274553 (PIK3CA)
   01524 Platinum drug resistance
    102274553 (PIK3CA)
   01522 Endocrine resistance
    102274553 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102274553 (PIK3CA)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102274553 (PIK3CA)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102274553 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 102274553
NCBI-ProteinID: XP_005892558
LinkDB
Position
Un
AA seq 1072 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
XXXXXXVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICT
RDPLSEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPE
QAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKK
ALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLT
DILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAK
RPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPY
GCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDL
FTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVL
TQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSF
DDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acgttaataacgataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtttatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaaacagaaatatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctattctcaactgccaatggac
tgttttacaatgccatcatattccagacgcatctccacagctacgccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatttatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaatcctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
annnnnnnnnnnnnnngtgtggtaaagtttccagatatgtcagtgattgaagagcatgcc
aattggtctgtatcccgtgaagcaggatttagttattcccatgcaggactgagtaacaga
ctagctagagacaatgaattaagagaaaatgataaagaacagctccgagcaatttgtaca
cgagatcctctatctgaaatcactgagcaagagaaagattttctgtggagccacagacac
tattgtgtaactatccccgaaattctacccaaattgcttctgtctgttaagtggaactct
agagatgaagtagctcagatgtactgcttggtaaaagattggcctccaatcaagcctgaa
caggctatggagcttctggactgcaattacccagatcctatggttcgaggttttgctgtt
cggtgcttagaaaaatatttaacagatgacaaactttctcagtacctaattcagctagta
caggtactaaaatatgaacagtatttggataacctgcttgtgagatttttactcaaaaaa
gcgttaactaatcaaaggatcggtcactttttcttttggcatttaaaatctgagatgcac
aataaaacagttagtcagaggtttggcctgcttttggagtcctattgccgtgcatgtggg
atgtatctgaagcaccttaataggcaagttgaggctatggaaaagctcattaacttgact
gacattctcaaacaagagaagaaggatgaaacacaaaaggtacagatgaagtttttagtt
gagcaaatgcggcgaccagatttcatggatgctctccagggctttctgtctcctctaaac
cctgctcatcagctgggaaatctcaggcttgaagagtgtcgaattatgtcttctgcaaaa
aggccactgtggttgaattgggagaacccagacatcatgtcagaattactctttcagaac
aatgagatcatctttaaaaatggggatgatttacggcaagatatgctaacccttcagatt
attcgcattatggaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttat
ggatgtctgtcaatcggtgactgtgtgggacttatcgaggtggtgagaaattctcacact
ataatgcagattcagtgtaaaggaggcctgaaaggtgcactgcagttcaacagccacaca
ctccatcagtggctcaaagacaagaacaagggggaaatatatgatgcagccatcgatttg
tttacacgatcatgtgctggatattgtgttgccaccttcattttgggaattggagatcgt
cacaatagtaatatcatggttaaagatgatggacaactgtttcatatagattttggacac
tttttggatcacaagaagaaaaaatttggttataaacgagagcgcgtgccgtttgttttg
acacaagatttcttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaa
tttgagaggtttcaggagatgtgttacaaggcttatctagctattcggcagcatgccaat
ctcttcataaatcttttctcaatgatgcttggctctggaatgccagaactgcaatctttt
gatgatattgcatacattcgaaagaccctagctttagataaaactgagcaagaggctttg
gagtatttcatgaaacaaatgaatgatgcacaccatggtggctggacaacaaaaatggat
tggatcttccacacaattaagcagcatgctttgaactga

KEGG   Bos mutus (wild yak): 102277548
Entry
102277548         CDS       T02919                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00562  Inositol phosphate metabolism
bom01100  Metabolic pathways
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05020  Prion disease
bom05100  Bacterial invasion of epithelial cells
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05146  Amoebiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102277548 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102277548 (PIK3CB)
   04014 Ras signaling pathway
    102277548 (PIK3CB)
   04015 Rap1 signaling pathway
    102277548 (PIK3CB)
   04370 VEGF signaling pathway
    102277548 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102277548 (PIK3CB)
   04668 TNF signaling pathway
    102277548 (PIK3CB)
   04066 HIF-1 signaling pathway
    102277548 (PIK3CB)
   04068 FoxO signaling pathway
    102277548 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102277548 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102277548 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102277548 (PIK3CB)
   04024 cAMP signaling pathway
    102277548 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102277548 (PIK3CB)
   04152 AMPK signaling pathway
    102277548 (PIK3CB)
   04150 mTOR signaling pathway
    102277548 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102277548 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102277548 (PIK3CB)
   04218 Cellular senescence
    102277548 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102277548 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102277548 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102277548 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102277548 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    102277548 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102277548 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102277548 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102277548 (PIK3CB)
   04660 T cell receptor signaling pathway
    102277548 (PIK3CB)
   04662 B cell receptor signaling pathway
    102277548 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102277548 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102277548 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102277548 (PIK3CB)
   04062 Chemokine signaling pathway
    102277548 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102277548 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102277548 (PIK3CB)
   04929 GnRH secretion
    102277548 (PIK3CB)
   04915 Estrogen signaling pathway
    102277548 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102277548 (PIK3CB)
   04917 Prolactin signaling pathway
    102277548 (PIK3CB)
   04926 Relaxin signaling pathway
    102277548 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102277548 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102277548 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102277548 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102277548 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102277548 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102277548 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102277548 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102277548 (PIK3CB)
   04380 Osteoclast differentiation
    102277548 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102277548 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102277548 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102277548 (PIK3CB)
   05206 MicroRNAs in cancer
    102277548 (PIK3CB)
   05205 Proteoglycans in cancer
    102277548 (PIK3CB)
   05203 Viral carcinogenesis
    102277548 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102277548 (PIK3CB)
   05231 Choline metabolism in cancer
    102277548 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102277548 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102277548 (PIK3CB)
   05212 Pancreatic cancer
    102277548 (PIK3CB)
   05225 Hepatocellular carcinoma
    102277548 (PIK3CB)
   05226 Gastric cancer
    102277548 (PIK3CB)
   05214 Glioma
    102277548 (PIK3CB)
   05221 Acute myeloid leukemia
    102277548 (PIK3CB)
   05220 Chronic myeloid leukemia
    102277548 (PIK3CB)
   05218 Melanoma
    102277548 (PIK3CB)
   05211 Renal cell carcinoma
    102277548 (PIK3CB)
   05215 Prostate cancer
    102277548 (PIK3CB)
   05213 Endometrial cancer
    102277548 (PIK3CB)
   05224 Breast cancer
    102277548 (PIK3CB)
   05222 Small cell lung cancer
    102277548 (PIK3CB)
   05223 Non-small cell lung cancer
    102277548 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102277548 (PIK3CB)
   05017 Spinocerebellar ataxia
    102277548 (PIK3CB)
   05020 Prion disease
    102277548 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102277548 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102277548 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102277548 (PIK3CB)
   04931 Insulin resistance
    102277548 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102277548 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102277548 (PIK3CB)
   05135 Yersinia infection
    102277548 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102277548 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102277548 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102277548 (PIK3CB)
   05161 Hepatitis B
    102277548 (PIK3CB)
   05160 Hepatitis C
    102277548 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102277548 (PIK3CB)
   05164 Influenza A
    102277548 (PIK3CB)
   05162 Measles
    102277548 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102277548 (PIK3CB)
   05163 Human cytomegalovirus infection
    102277548 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102277548 (PIK3CB)
   05169 Epstein-Barr virus infection
    102277548 (PIK3CB)
   05165 Human papillomavirus infection
    102277548 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102277548 (PIK3CB)
   05142 Chagas disease
    102277548 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102277548 (PIK3CB)
   01524 Platinum drug resistance
    102277548 (PIK3CB)
   01522 Endocrine resistance
    102277548 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102277548 (PIK3CB)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102277548 (PIK3CB)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102277548 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 102277548
NCBI-ProteinID: XP_005908999
UniProt: L8HUM8
LinkDB
Position
Un
AA seq 1070 aa
MCFYFMMPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISCIKQMLW
KQVTNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKHTYPPEL
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHSLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMVAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEPLEFDINTCDLPRMTRLCFAVYAVLDKVKTKKSTKTM
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPHALPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKTEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttctacttcatgatgcctcctgctatggcagacgtccttgacatctgggcagtg
gactcacagatagcgtctgatggctccatacccgtggattttcttttgcccactgggatt
tatatccagttggaggtgcctcgtgaagctaccatttcctgtattaagcagatgttatgg
aaacaagttaccaattacccaatgtttaacctccttatggaaatcgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggaactcgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcagattcagtgaggaaaagatt
cagtcgcttgtgggattatcttggatggattggctaaagcatacctatccacctgagctt
gaaccatccatccctgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaggtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtctgactattcatgggaaagaagatgaa
gttagcccttatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cactcactaattcagttccagtatatccggaactgtgtaatgaacagaacattgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtatgaacaggagatggttgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaatcctttccaaattgtcttggttaaagga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggccggcctttttcatggt
accgaactcctgtgtaaaactgtcgtaagctcagagatatcagggaagaatgatcatatt
tggaatgaaccactggaatttgatatcaacacttgtgacctgccacgaatgactcgatta
tgttttgctgtttatgcagttttggataaagtgaaaactaagaaatcaactaaaaccatg
aatccctctaagtatcagaccatcaggaaatctggaaaagtgcattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagatataatattacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatacagaaaatgcaacagctttgcacataaaattcccagagaataaaaaa
caaccttattactatcctccctttgataagattattgaaaaagcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatcctttgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacacgcgttgccgaaattgctgctgtcgatc
aagtggaataaacttgaggatgttgctcagcttcaagcactgcttcagatttggcctaaa
ctgcccccccgggaggcccttgagcttctagatttcaactatccagatcagtatgtgcga
gaatatgctgtgggctgcctgcaacagatgagtgatgaagaactctctcaatatctttta
cagttggtgcaagttttaaaatatgagccttttcttgattgtgccttgtctagattccta
ctagaaagagcacttgctaatcggaggatagggcagtttttattttggcacctcagatct
gaagtacacattcccgctgtttcagtacaatttggtgttatccttgaagcgtactgccgg
ggaagcgtaggtcacatgaaggcgctttctaagcaggttgaagcactcaataaactaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaatagagccaaagggaaagaa
gcaatgcacacttgtttaaaacagaatgcttaccgtgaagccctctctgacctgcaatca
cctctcaacccatgtgttatcctctcagaactctatgttgagaagtgtaaatacatggat
tccaaaatgaagcctttgtggcttgtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggaccttcggatgctaccttacggc
tgcttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgttgctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctatcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acttatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgccggcatgggaatctcttc
atcacgctctttgcactgatgttgactgcagggcttcctgagctcacctcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagactgaagaagaagcactcaagcaa
ttcaagcaaaaatttgatgaggcactcagggaaagttggactactaaagtcaattggatg
gcccacacagttcgcaaagactacagatcttaa

KEGG   Bos mutus (wild yak): 102280296
Entry
102280296         CDS       T02919                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05020  Prion disease
bom05100  Bacterial invasion of epithelial cells
bom05135  Yersinia infection
bom05142  Chagas disease
bom05146  Amoebiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102280296 (PIK3R3)
   04014 Ras signaling pathway
    102280296 (PIK3R3)
   04015 Rap1 signaling pathway
    102280296 (PIK3R3)
   04370 VEGF signaling pathway
    102280296 (PIK3R3)
   04630 JAK-STAT signaling pathway
    102280296 (PIK3R3)
   04668 TNF signaling pathway
    102280296 (PIK3R3)
   04066 HIF-1 signaling pathway
    102280296 (PIK3R3)
   04068 FoxO signaling pathway
    102280296 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    102280296 (PIK3R3)
   04072 Phospholipase D signaling pathway
    102280296 (PIK3R3)
   04071 Sphingolipid signaling pathway
    102280296 (PIK3R3)
   04024 cAMP signaling pathway
    102280296 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    102280296 (PIK3R3)
   04152 AMPK signaling pathway
    102280296 (PIK3R3)
   04150 mTOR signaling pathway
    102280296 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102280296 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    102280296 (PIK3R3)
   04218 Cellular senescence
    102280296 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102280296 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102280296 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102280296 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102280296 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    102280296 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    102280296 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    102280296 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    102280296 (PIK3R3)
   04660 T cell receptor signaling pathway
    102280296 (PIK3R3)
   04662 B cell receptor signaling pathway
    102280296 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    102280296 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    102280296 (PIK3R3)
   04670 Leukocyte transendothelial migration
    102280296 (PIK3R3)
   04062 Chemokine signaling pathway
    102280296 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102280296 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    102280296 (PIK3R3)
   04929 GnRH secretion
    102280296 (PIK3R3)
   04915 Estrogen signaling pathway
    102280296 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    102280296 (PIK3R3)
   04917 Prolactin signaling pathway
    102280296 (PIK3R3)
   04926 Relaxin signaling pathway
    102280296 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    102280296 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    102280296 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102280296 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102280296 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    102280296 (PIK3R3)
   04722 Neurotrophin signaling pathway
    102280296 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102280296 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    102280296 (PIK3R3)
   04380 Osteoclast differentiation
    102280296 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    102280296 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    102280296 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102280296 (PIK3R3)
   05206 MicroRNAs in cancer
    102280296 (PIK3R3)
   05205 Proteoglycans in cancer
    102280296 (PIK3R3)
   05203 Viral carcinogenesis
    102280296 (PIK3R3)
   05230 Central carbon metabolism in cancer
    102280296 (PIK3R3)
   05231 Choline metabolism in cancer
    102280296 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102280296 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102280296 (PIK3R3)
   05212 Pancreatic cancer
    102280296 (PIK3R3)
   05225 Hepatocellular carcinoma
    102280296 (PIK3R3)
   05226 Gastric cancer
    102280296 (PIK3R3)
   05214 Glioma
    102280296 (PIK3R3)
   05221 Acute myeloid leukemia
    102280296 (PIK3R3)
   05220 Chronic myeloid leukemia
    102280296 (PIK3R3)
   05218 Melanoma
    102280296 (PIK3R3)
   05211 Renal cell carcinoma
    102280296 (PIK3R3)
   05215 Prostate cancer
    102280296 (PIK3R3)
   05213 Endometrial cancer
    102280296 (PIK3R3)
   05224 Breast cancer
    102280296 (PIK3R3)
   05222 Small cell lung cancer
    102280296 (PIK3R3)
   05223 Non-small cell lung cancer
    102280296 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102280296 (PIK3R3)
   05017 Spinocerebellar ataxia
    102280296 (PIK3R3)
   05020 Prion disease
    102280296 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102280296 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102280296 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    102280296 (PIK3R3)
   04931 Insulin resistance
    102280296 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102280296 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102280296 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    102280296 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102280296 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    102280296 (PIK3R3)
   05161 Hepatitis B
    102280296 (PIK3R3)
   05160 Hepatitis C
    102280296 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    102280296 (PIK3R3)
   05164 Influenza A
    102280296 (PIK3R3)
   05162 Measles
    102280296 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    102280296 (PIK3R3)
   05163 Human cytomegalovirus infection
    102280296 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102280296 (PIK3R3)
   05169 Epstein-Barr virus infection
    102280296 (PIK3R3)
   05165 Human papillomavirus infection
    102280296 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102280296 (PIK3R3)
   05142 Chagas disease
    102280296 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102280296 (PIK3R3)
   01524 Platinum drug resistance
    102280296 (PIK3R3)
   01522 Endocrine resistance
    102280296 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102280296 (PIK3R3)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102280296 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act DUF5638 Cupin_8 Fez1
Other DBs
NCBI-GeneID: 102280296
NCBI-ProteinID: XP_005894274
LinkDB
Position
Un
AA seq 507 aa
MGPSQLVRAPRPRGLISPYRRPGVGWPRPHFPKMFKCSRRRYRQKRQGPAGTTVTTNLAS
VATDINDTQTATTRVLILAPQALPPKPPKPMTSAITNGIKDSSVSLQDAEWYWGDISREE
VNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVV
ELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKE
YDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRKEGNEKEIE
RIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLV
WLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYG
KPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYGSLKELVLHYQR
TSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggggccttctcagcttgtccgtgcccctcggccccggggcttaatttccccttaccgc
aggccaggcgtgggttggcctcggccccactttcccaagatgttcaagtgtagccgcaga
aggtaccggcagaaacggcaaggcccagctggcaccactgtaaccaccaatcttgccagt
gtggccacggatatcaacgacacccaaactgccaccaccagggtgttgatccttgcaccg
caagctcttccaccaaagccacctaagccaatgacttcagccattacaaatggaataaag
gacagttctgtttctcttcaggatgcagaatggtactggggggatatttcaagggaggag
gtaaatgacaaattgcgggacatgccagatggtaccttcttggtcagagatgcctcaacc
aaaatgcagggagattacactttgaccttgcggaagggaggcaataataagctaataaag
atttatcatcgagatggtaaatatggcttttctgatcctctgacatttaattctgtggtg
gagctcattagccactatcatcatgaatctcttgcccagtacaatcccaaacttgatgtg
aaactgatgtacccagtgtccagataccaacaggatcagttggtaaaagaagataatatt
gatgctgtcggtaaaaaactgcaggagtatcactctcagtatcaggaaaagagtaaagaa
tatgacagactatatgaagaatataccagaacatcccaggaaatacagatgaagaggact
gcaattgaagcttttaatgaaacaattaaaatatttgaagagcagtgtcatacacaagaa
caacatagcaaagaatatattgagcgatttcgaaaagaagggaatgaaaaggaaattgaa
cgaattatgatgaattatgacaagctgaaatcacgtctgggtgagattcatgatagcaaa
atgcgtcttgaacaggatttgaagaaacaagctttggataaccgagaaatagataaaaaa
atgaatagtatcaaacctgacctgatccagctgcgcaagatccgagatcagcaccttgtg
tggctcaatcacaaaggagtgagacagaagcgcctaaatgcctggctgggaatcaagaat
gaggatgctgatgagacctattttatcaatgaggaagatgaaaacctgccccattatgat
gagaaaacctggtttgttgaggatatcaaccgagtacaagcagaggacttgctctatggg
aaacctgacggtgcattcttaatccgtgagagtagcaagaaaggatgttatgcttgctct
gtggtcgccgatggggaggtgaagcactgcgtcatctacagcaccgctcggggctacggc
ttcgcggagccctacaacctgtacggctccctgaaggagctggtgctccactaccagcgg
acgtccctcgtgcagcacaacgactctctcaacgtcaggctcgcctaccctgtccacgca
cagatgccctcgctctgcagataa

KEGG   Bos mutus (wild yak): 102286868
Entry
102286868         CDS       T02919                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04960  Aldosterone-regulated sodium reabsorption
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05020  Prion disease
bom05100  Bacterial invasion of epithelial cells
bom05135  Yersinia infection
bom05142  Chagas disease
bom05146  Amoebiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102286868 (PIK3R2)
   04014 Ras signaling pathway
    102286868 (PIK3R2)
   04015 Rap1 signaling pathway
    102286868 (PIK3R2)
   04370 VEGF signaling pathway
    102286868 (PIK3R2)
   04630 JAK-STAT signaling pathway
    102286868 (PIK3R2)
   04668 TNF signaling pathway
    102286868 (PIK3R2)
   04066 HIF-1 signaling pathway
    102286868 (PIK3R2)
   04068 FoxO signaling pathway
    102286868 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    102286868 (PIK3R2)
   04072 Phospholipase D signaling pathway
    102286868 (PIK3R2)
   04071 Sphingolipid signaling pathway
    102286868 (PIK3R2)
   04024 cAMP signaling pathway
    102286868 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    102286868 (PIK3R2)
   04152 AMPK signaling pathway
    102286868 (PIK3R2)
   04150 mTOR signaling pathway
    102286868 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102286868 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    102286868 (PIK3R2)
   04218 Cellular senescence
    102286868 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102286868 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102286868 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102286868 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102286868 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    102286868 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    102286868 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    102286868 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    102286868 (PIK3R2)
   04660 T cell receptor signaling pathway
    102286868 (PIK3R2)
   04662 B cell receptor signaling pathway
    102286868 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    102286868 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    102286868 (PIK3R2)
   04670 Leukocyte transendothelial migration
    102286868 (PIK3R2)
   04062 Chemokine signaling pathway
    102286868 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102286868 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    102286868 (PIK3R2)
   04929 GnRH secretion
    102286868 (PIK3R2)
   04915 Estrogen signaling pathway
    102286868 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    102286868 (PIK3R2)
   04917 Prolactin signaling pathway
    102286868 (PIK3R2)
   04926 Relaxin signaling pathway
    102286868 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    102286868 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    102286868 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102286868 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102286868 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    102286868 (PIK3R2)
   04722 Neurotrophin signaling pathway
    102286868 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102286868 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102286868 (PIK3R2)
   04380 Osteoclast differentiation
    102286868 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    102286868 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    102286868 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102286868 (PIK3R2)
   05206 MicroRNAs in cancer
    102286868 (PIK3R2)
   05205 Proteoglycans in cancer
    102286868 (PIK3R2)
   05203 Viral carcinogenesis
    102286868 (PIK3R2)
   05230 Central carbon metabolism in cancer
    102286868 (PIK3R2)
   05231 Choline metabolism in cancer
    102286868 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102286868 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102286868 (PIK3R2)
   05212 Pancreatic cancer
    102286868 (PIK3R2)
   05225 Hepatocellular carcinoma
    102286868 (PIK3R2)
   05226 Gastric cancer
    102286868 (PIK3R2)
   05214 Glioma
    102286868 (PIK3R2)
   05221 Acute myeloid leukemia
    102286868 (PIK3R2)
   05220 Chronic myeloid leukemia
    102286868 (PIK3R2)
   05218 Melanoma
    102286868 (PIK3R2)
   05211 Renal cell carcinoma
    102286868 (PIK3R2)
   05215 Prostate cancer
    102286868 (PIK3R2)
   05213 Endometrial cancer
    102286868 (PIK3R2)
   05224 Breast cancer
    102286868 (PIK3R2)
   05222 Small cell lung cancer
    102286868 (PIK3R2)
   05223 Non-small cell lung cancer
    102286868 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102286868 (PIK3R2)
   05017 Spinocerebellar ataxia
    102286868 (PIK3R2)
   05020 Prion disease
    102286868 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102286868 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102286868 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    102286868 (PIK3R2)
   04931 Insulin resistance
    102286868 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102286868 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102286868 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    102286868 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286868 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    102286868 (PIK3R2)
   05161 Hepatitis B
    102286868 (PIK3R2)
   05160 Hepatitis C
    102286868 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    102286868 (PIK3R2)
   05164 Influenza A
    102286868 (PIK3R2)
   05162 Measles
    102286868 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    102286868 (PIK3R2)
   05163 Human cytomegalovirus infection
    102286868 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286868 (PIK3R2)
   05169 Epstein-Barr virus infection
    102286868 (PIK3R2)
   05165 Human papillomavirus infection
    102286868 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102286868 (PIK3R2)
   05142 Chagas disease
    102286868 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102286868 (PIK3R2)
   01524 Platinum drug resistance
    102286868 (PIK3R2)
   01522 Endocrine resistance
    102286868 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102286868 (PIK3R2)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102286868 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4
Other DBs
NCBI-GeneID: 102286868
NCBI-ProteinID: XP_005897971
LinkDB
Position
Un
AA seq 710 aa
MAGPEGFQSRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPESGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSYRPEPPAVRTDWSLSDVEQWDAAALSDGVKGFLLALPA
PLVTPEAAAEAHRALREAAGPGGPALEPPTLPLHHALTLRFLLQHLGRVAGRAPAPGPAV
RALGATFGPLLLRAPPPPSPPPGGAPDGTEPTPDFPALLVEKLLQEHLEEQEVAPPALPP
KPPKTKPAPTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGE
YTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYP
VSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAF
NETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQ
ELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQ
YSLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGD
TKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHTSLATLFRCPTLGVMG
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggctggccctgagggcttccaatcccgtgcattgtacccattccgccgggagcggccg
gaggacctggagctgcttccgggtgatgtgctggtggtgagcagggccgccctgcaggcg
ctgggcgtggccgagggcaacgagcgctgcccgcagagcgtaggctggatgcctggcctc
aatgagcgtacccggcagcgcggcgacttccctggcacctatgtggagttcctggggccc
gtggccctggcccggcctggccctcgcccacgtggcccccgcccactgcccgccaggccc
cgagacgggccccctgagtcaggccttacactccctgacctacccgagcagttctccccc
cctgatgtggctccccctatcctggtgaagctggtggaggccattgaacggacagggctg
gacagctacaggcctgagccacctgccgtgcgcacagactggtccctgagtgatgtggag
cagtgggatgcggcagccctgtcagatggtgtgaaaggcttcctgctggcgctgccagcg
cccctcgtgacacccgaggctgcggccgaggcacaccgagccctgcgggaggctgcgggg
cccggggggccggccttggagcccccgacgctgccactgcaccatgcgctcacgctgcgc
ttcctgctccagcacctgggccgggtggccgggcgcgccccagccccgggccccgcggtc
cgtgccctgggcgccaccttcgggccgctactgctacgcgcgccgccgccgccctctccg
ccgccagggggcgcacccgacgggaccgagcccacccctgactttccggcgctgctggtg
gagaagctgcttcaggaacatctggaggagcaggaggttgcccccccagcactgccacca
aaaccccccaagacaaagccagcccccacaggcctggccaatgggggcagcccaccctcc
ctgcaggacgccgagtggtactggggtgacatctccagggaggaggtaaacgagaaactt
cgggacacgcccgatggcaccttcctggtccgagatgcctccagcaagatccagggagag
tacacgctgaccctcaggaagggcggaaacaacaagctgatcaaggtcttccaccgagat
gggcactatggcttctcggagccgctcaccttctgctctgtcgtggacctcatcacccac
taccgccatgagtcactggcccagtacaacgccaagctggacacgcggctcctctacccg
gtgtccaagtaccaacaggaccagatcgtcaaggaggacagcgtggaggcggtgggtgcc
cagctcaaggtctaccaccagcagtaccaggacaagagccgcgagtacgaccagctctac
gaggagtacacacgcacctcccaggaactgcagatgaagcgcacagccatcgaagccttc
aatgagaccatcaagatctttgaagagcagggccagacgcaggagaagtgcagcaaggaa
tatctggagcgcttccgacgtgagggcaatgagaaagaaatgcagaggatcctgctaaac
tcggagcggctcaagtctcgcattgccgagatccacgagagccgcacaaagctggagcag
gagctgcgggcacaggcctctgacaaccgagagatcgacaagcgcatgaacagcctcaag
ccagacctcatgcagttgcgcaagatccgagaccagtaccttgtgtggctcactcagaag
ggtgcccggcagaagaaaatcaacgaatggttggggatcaagaacgagactgaggaccag
tactcactgatggaggatgaggatgacctcccccaccacgaggaacgcacctggtatgta
ggcaagatcaaccgcacccaagctgaggaaatgctgagtggcaagcgggacggtaccttc
cttatccgtgagagcagccagcggggttgctacgcctgttctgtggtggtggacggggat
accaagcactgcgtcatctaccgcacggccaccggcttcggctttgcggagccctacaac
ctgtacgggtccctcaaggagctcgtcctccactatcaacacacatccctagctactctt
tttcgctgccccacactaggtgttatgggttaa

DBGET integrated database retrieval system