KEGG   Bos mutus (wild yak): 102267018
Entry
102267018         CDS       T02919                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bom  Bos mutus (wild yak)
Pathway
bom04010  MAPK signaling pathway
bom04060  Cytokine-cytokine receptor interaction
bom04068  FoxO signaling pathway
bom04144  Endocytosis
bom04218  Cellular senescence
bom04350  TGF-beta signaling pathway
bom04380  Osteoclast differentiation
bom04390  Hippo signaling pathway
bom04520  Adherens junction
bom04659  Th17 cell differentiation
bom04926  Relaxin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05142  Chagas disease
bom05161  Hepatitis B
bom05166  Human T-cell leukemia virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05220  Chronic myeloid leukemia
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102267018 (TGFBR2)
   04350 TGF-beta signaling pathway
    102267018 (TGFBR2)
   04390 Hippo signaling pathway
    102267018 (TGFBR2)
   04068 FoxO signaling pathway
    102267018 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102267018 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102267018 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    102267018 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102267018 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102267018 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102267018 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102267018 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267018 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    102267018 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102267018 (TGFBR2)
   05212 Pancreatic cancer
    102267018 (TGFBR2)
   05225 Hepatocellular carcinoma
    102267018 (TGFBR2)
   05226 Gastric cancer
    102267018 (TGFBR2)
   05220 Chronic myeloid leukemia
    102267018 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102267018 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102267018 (TGFBR2)
   05161 Hepatitis B
    102267018 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102267018 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102267018 (TGFBR2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102267018 (TGFBR2)
Protein kinases [BR:bom01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102267018 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102267018
NCBI-ProteinID: XP_005894227
LinkDB
Position
Un
AA seq 532 aa
MMVTDHNGAIKLSQLCKFCDVRSSTCDNQKSCWSNCSITAICEKPEEVCVAVWRKNDENI
TLETVCHDPKIAYHGFVLDDAASSKCIMKERKGSGETFFMCSCSSEECNDHIIFSEEYTS
SNPDLLLVIFQVTGVSLLPPLGIAIAVIITFYCYRIHRQQKLSPAWDSGKPRKLMEFSEH
LAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRRLGGSLARGIAHLHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCE
TLAECWDHDPEARLTAQCVAERFSELEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgatggtcactgaccacaacggcgccatcaagctgtcgcagctgtgtaagttctgcgac
gtgcggtcgtccacctgtgacaaccagaagtcctgctggagcaactgcagcatcacggcc
atctgcgagaagccggaggaggtctgcgtggctgtctggaggaagaatgatgagaatatc
acgctggagacagtctgccacgaccccaagattgcctaccatggatttgtcctggacgat
gctgcttcttcaaagtgtatcatgaaggaaagaaaggggtccggagagactttcttcatg
tgctcctgcagctccgaagagtgcaatgaccacatcatcttctccgaagagtacaccagc
agtaaccccgacttgctgctggttatcttccaagtgacaggcgtcagcctcctgccaccg
ctgggcatcgccatcgcagtcatcatcactttctactgctaccgcatccaccggcagcag
aagctgagcccagcctgggactcgggcaagccgcgcaagctgatggagttcagtgagcac
ctggccatcatcctggaggacgaccgctccgacatcagctccacctgcgccaacaacatc
aaccacaacacggagctgctgcccatcgagctggacaccctggtgggcaaggggcgcttc
gccgaggtctacaaggccaagctgaagcagaacacgtctgagcagttcgagaccgtggcc
gtcaagatcttcccctacgaggagtatgcctcctggaagacggagaaggacatcttctcg
gacatcaacctcaagcacgagaacatcctgcagttcctgacggccgaggagcgcaagacg
gagctgggcaagcagtactggctcatcactgccttccacgccaagggcaacctgcaggag
tacctgacgcgccacgtcatcagctgggaggacctgcgccggctgggcggctcgctggcc
cgtggcatcgcgcacctgcacagcgaccacaccctgtgcggccggcccaagatgcccatc
gtgcacagggacctcaagagctccaacatcctggtcaagggcgacctcacctgctgcctc
tgcgacttcgggctctcactgcggctggaccccaccctgtcagtggatgacctggccaac
agtgggcaggtgggaacggcgagatacatggctccagaggtcctcgagtccaggatgaat
ctggagaacgtggagtccttcaagcagacggatgtctactccatggccctggtgctctgg
gagatgacgtctcgctgcaacgcagtgggagaagtgaaggactatgagcctccgttcggg
tctaaggtgcgggagcatccctgtgtggaaagcatgaaggacaacgtgctgagagatcga
ggccgaccagagattcccagctcctggctcaaccaccagggcatccagacggtgtgcgag
acgctggccgaatgctgggaccatgaccccgaggcccggctcacggcgcagtgcgtggcc
gagcgcttcagcgagctggagcacctggacaggctctccgggaggagcagctcggaggag
aagatccccgaagatggctccctcaacactaccaaatag

DBGET integrated database retrieval system