KEGG   Bos mutus (wild yak): 102267169
Entry
102267169         CDS       T02919                                 

Gene name
RB1
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04110  Cell cycle
bom04218  Cellular senescence
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05212  Pancreatic cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102267169 (RB1)
   04218 Cellular senescence
    102267169 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267169 (RB1)
   05203 Viral carcinogenesis
    102267169 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102267169 (RB1)
   05225 Hepatocellular carcinoma
    102267169 (RB1)
   05226 Gastric cancer
    102267169 (RB1)
   05214 Glioma
    102267169 (RB1)
   05220 Chronic myeloid leukemia
    102267169 (RB1)
   05218 Melanoma
    102267169 (RB1)
   05219 Bladder cancer
    102267169 (RB1)
   05215 Prostate cancer
    102267169 (RB1)
   05224 Breast cancer
    102267169 (RB1)
   05222 Small cell lung cancer
    102267169 (RB1)
   05223 Non-small cell lung cancer
    102267169 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102267169 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102267169 (RB1)
   05161 Hepatitis B
    102267169 (RB1)
   05160 Hepatitis C
    102267169 (RB1)
   05163 Human cytomegalovirus infection
    102267169 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102267169 (RB1)
   05169 Epstein-Barr virus infection
    102267169 (RB1)
   05165 Human papillomavirus infection
    102267169 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102267169 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102267169 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102267169 (RB1)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102267169 (RB1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102267169 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 TFIIB
Other DBs
NCBI-GeneID: 102267169
NCBI-ProteinID: XP_005904587
LinkDB
Position
Un
AA seq 949 aa
MPADVKGRVLSVSYPPGSSAEAPCGVLLEGGFRTKRVFLCSRGIIFLLGKRTYLIGRCGD
SIYLHLRLEFEETEEPDFTALCQKLKLPDHVRERAWLTWEKVSSVDGVLEGYVQKKKELW
GICIFIAAVDLDEMPFTFTELQKNIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLC
ALYSKLERTCELIYLTQPSSSISTEINSMLVLKVSWITFLLAKGQVLQMEDDLVISFQLM
LCVLDYFIKLSPPALLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCK
EHECNIDEVKNVYFKNFIPFMNSLGIVASNGLPEVENLSKQYEEIYLKNKDLDARLFLDH
DKTLQADPTDSFEMQRTPRKSNPDEEVNMILPQTPVRTVMNTIQQLMMILNSASDQPSEN
LISYFNNCTVNPKDSILKRVKDIGDVFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMES
MLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSMSQSLDTGTDLSFPWILN
VFNLKAFDFYKVIESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDR
EGPVDHFEPACTLNLPLQNNHTAADMYLSPVRSPKKKGPTPRVNSTPNSEAQATSAFQTQ
KPLKSTSLSLFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRH
LDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSV
FMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGL
PTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDI
EGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNESVDTSNREDK
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgcccgcggacgtgaagggtagggtcctgagtgtcagttatcccccaggaagctcggct
gaggcgccttgtggcgttctcttagaagggggttttcgtacaaaacgagtgtttttgtgc
tcacgtggaattatttttcttctcggtaagaggacttacctaataggccgatgtggggat
tcaatctaccttcatctaaggcttgagtttgaagaaactgaagaacctgattttactgca
ttatgtcagaaattaaagctaccagatcatgtcagagaaagagcttggttaacttgggaa
aaagtttcatccgtggatggagtattggaaggttatgttcaaaagaaaaaggaactgtgg
ggaatctgtatttttatcgcagcagttgacttagatgagatgccgttcactttcactgag
ctacagaaaaacattgaaaccagtgtctataaattctttgatttactaaaagaaatcgat
accagtaccaaagttgataatgctatgtcaagactgttgaagaagtataatgtgttgtgt
gcactctacagcaaattagaaaggacatgtgagcttatatatttgacacaacccagcagt
tcgatatctactgaaataaattctatgttggtgctaaaggtttcttggatcacattttta
ttagctaaaggacaagtattacaaatggaagatgatctggtgatctcatttcaattaatg
ctgtgtgtccttgactattttatcaaactctcacctcctgcattgctcaaagaaccatac
aaaacagctgtaatacctattaatggttcacctcgaacaccaaggcgaggtcagaacagg
agtgcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaa
gaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttatacctttt
atgaattctcttggaattgtagcttctaatggacttccagaggtggaaaatctctctaaa
caatatgaagaaatttaccttaaaaacaaagatctagatgcaagattatttctggatcat
gataaaactcttcaggctgatcctacagacagttttgaaatgcaaagaacaccacgaaaa
agtaaccctgatgaagaggtgaatatgattcttccacagactccagttagaactgttatg
aatactatccaacaattaatgatgatcttaaattcagcaagtgatcaaccatcggaaaat
ctgatttcctattttaataattgtacagtgaatccaaaggacagtatcctgaaaagagtg
aaggatattggggacgtctttaaagagaaatttgctaaagctgtgggacaaggatgtatg
gaaattggatcacagcgatacaaacttggagtccgattgtattaccgagtaatggaatcc
atgcttaaatcagaagaagaacgattatccattcaaaattttagcaaactcctgaatgac
aacatctttcatatgtctttgttggcatgcgctcttgaggttgtaatggctacctatagc
agaagtatgtctcagagcctggatactggaacagatctatccttcccatggattctgaat
gtatttaacttaaaagcttttgatttttacaaagtgattgaaagtttcatcaaagcagaa
gccaacctgaccagagaaatgattaaacatttagaacgatgtgaacatcgaatcatggag
tcccttgcctggctctcagattcacctttatttgatcttattaaacaagcaaaggaccga
gaaggaccagttgatcactttgaacctgcctgtactctcaaccttcctctccagaataat
cacactgcagcagatatgtatctttctcctgtaagatccccaaagaaaaaagggccaact
ccacgtgtaaattctactccaaattcagaggcacaagcaacctcagccttccagactcag
aagccattgaaatctacctccctttcactcttctacaaaaaagtgtatcgactagcatat
cttcgactgaacaccctgtgtgcacgccttctgtctgaccacccagaactagagcatatc
atctggacccttttccagcacacactgcaaaatgagtatgaactcatgagagacaggcat
ttggaccagattatgatgtgttctatgtatggcatatgcaaagtgaagaatatagacctt
aaattcaaaatcattgtcacagcatacaaagatcttcctcatgctgttcaggagacattc
aaacgtgttttgatcagagaagaggagtatgattccattatcgtattctataattcggtc
ttcatgcagagactgaaaacaaatattttgcagtacgcttccaccaggccccctaccttg
tcaccgattcctcacattcctcgaagtccttacaagttttctagttcacctttacggatt
cctggggggaacatctatatatcacccctaaagaatccatataaaatttcagaaggtctg
ccgacaccaacaaaaatgactccaagatcaagaatcttagtatcaatcggtgaatcattt
gggacttcagagaagttccagaaaataaatcaaatggtatgtaacagtgaccgcgtgctc
aaaagaagtgctgaaggaagcaatcctcctaaaccactgaaaaaactgcgctttgacatc
gaaggatccgatgaagcagatggaagtaaacatctcccaggggaatccaaatttcaacag
aaactggcagaaatgacatctactcgaacacgaatgcaaaagcagaaaatgaatgagagc
gtggatacctcaaacagggaagacaagtga

DBGET integrated database retrieval system