KEGG   Bos mutus (wild yak): 102267895
Entry
102267895         CDS       T02919                                 

Gene name
JUN
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04024  cAMP signaling pathway
bom04137  Mitophagy - animal
bom04210  Apoptosis
bom04310  Wnt signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04530  Tight junction
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04912  GnRH signaling pathway
bom04915  Estrogen signaling pathway
bom04921  Oxytocin signaling pathway
bom04926  Relaxin signaling pathway
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05132  Salmonella infection
bom05133  Pertussis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05161  Hepatitis B
bom05162  Measles
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05224  Breast cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
bom05323  Rheumatoid arthritis
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102267895 (JUN)
   04012 ErbB signaling pathway
    102267895 (JUN)
   04310 Wnt signaling pathway
    102267895 (JUN)
   04668 TNF signaling pathway
    102267895 (JUN)
   04024 cAMP signaling pathway
    102267895 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102267895 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    102267895 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102267895 (JUN)
   04530 Tight junction
    102267895 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102267895 (JUN)
   04621 NOD-like receptor signaling pathway
    102267895 (JUN)
   04625 C-type lectin receptor signaling pathway
    102267895 (JUN)
   04660 T cell receptor signaling pathway
    102267895 (JUN)
   04658 Th1 and Th2 cell differentiation
    102267895 (JUN)
   04659 Th17 cell differentiation
    102267895 (JUN)
   04657 IL-17 signaling pathway
    102267895 (JUN)
   04662 B cell receptor signaling pathway
    102267895 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102267895 (JUN)
   04915 Estrogen signaling pathway
    102267895 (JUN)
   04921 Oxytocin signaling pathway
    102267895 (JUN)
   04926 Relaxin signaling pathway
    102267895 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102267895 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102267895 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267895 (JUN)
   05203 Viral carcinogenesis
    102267895 (JUN)
   05231 Choline metabolism in cancer
    102267895 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102267895 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102267895 (JUN)
   05211 Renal cell carcinoma
    102267895 (JUN)
   05224 Breast cancer
    102267895 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102267895 (JUN)
   05321 Inflammatory bowel disease
    102267895 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    102267895 (JUN)
   05031 Amphetamine addiction
    102267895 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102267895 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102267895 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102267895 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102267895 (JUN)
   05135 Yersinia infection
    102267895 (JUN)
   05133 Pertussis
    102267895 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102267895 (JUN)
   05170 Human immunodeficiency virus 1 infection
    102267895 (JUN)
   05161 Hepatitis B
    102267895 (JUN)
   05171 Coronavirus disease - COVID-19
    102267895 (JUN)
   05162 Measles
    102267895 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102267895 (JUN)
   05169 Epstein-Barr virus infection
    102267895 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102267895 (JUN)
   05142 Chagas disease
    102267895 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102267895 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102267895 (JUN)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    102267895 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Jnk-SapK_ap_N Fib_alpha TFIIA DUF3450 TMF_DNA_bd Paralemmin Seryl_tRNA_N
Other DBs
NCBI-GeneID: 102267895
NCBI-ProteinID: XP_014336129
LinkDB
Position
Un
AA seq 274 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSGLAFPAQPQQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 825 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg
aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc
ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctaatc
atacagtccagcaacgggcatatcaccaccacgccgacccctacccagttcctgtgcccc
aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcgggcctggcctttcccgcgcagccc
cagcagcagcagcagcaaccgccgcagccgccgcaccacctgccccagcagatccctgtg
cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggg
gaaacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcagagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc
gcgcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg
gccaatatgctcagggaacaggtggcccagcttaaacagaaagtcatgaaccacgttaac
agcgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system