KEGG   Bos mutus (wild yak): 102267975
Entry
102267975         CDS       T02919                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04020  Calcium signaling pathway
bom04066  HIF-1 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04510  Focal adhesion
bom04520  Adherens junction
bom04530  Tight junction
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05215  Prostate cancer
bom05219  Bladder cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102267975 (ERBB2)
   04012 ErbB signaling pathway
    102267975 (ERBB2)
   04066 HIF-1 signaling pathway
    102267975 (ERBB2)
   04020 Calcium signaling pathway
    102267975 (ERBB2)
   04151 PI3K-Akt signaling pathway
    102267975 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102267975 (ERBB2)
   04520 Adherens junction
    102267975 (ERBB2)
   04530 Tight junction
    102267975 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102267975 (ERBB2)
   05206 MicroRNAs in cancer
    102267975 (ERBB2)
   05205 Proteoglycans in cancer
    102267975 (ERBB2)
   05230 Central carbon metabolism in cancer
    102267975 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102267975 (ERBB2)
   05226 Gastric cancer
    102267975 (ERBB2)
   05219 Bladder cancer
    102267975 (ERBB2)
   05215 Prostate cancer
    102267975 (ERBB2)
   05213 Endometrial cancer
    102267975 (ERBB2)
   05224 Breast cancer
    102267975 (ERBB2)
   05223 Non-small cell lung cancer
    102267975 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102267975 (ERBB2)
   01524 Platinum drug resistance
    102267975 (ERBB2)
   01522 Endocrine resistance
    102267975 (ERBB2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102267975 (ERBB2)
Protein kinases [BR:bom01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102267975 (ERBB2)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102267975 (ERBB2)
CD molecules [BR:bom04090]
 Proteins
  102267975 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 102267975
NCBI-ProteinID: XP_005898067
LinkDB
Position
Un
AA seq 1222 aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPADASLSFLQEIQEVQGYVLIAHNQ
VSQVPLQRLRIVRGTQLFEEHYALAVLDNGDFLESAAPAAGTAPGGLQELQLRSLTEILK
GGVLIQRNPQLCHQDTILWEDIFHKNNQLPLKQIDTNRSRACAPCSPACKAPNCWGESSQ
DCQSLTRTVCASGCARCKGPQPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLNNQEVTAEDGTQR
CEKCSKPCAPVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFAGDPDSNIA
PLQAEQLKVFESLEEITGYLYISAWPDSLPDLSVFQNLRVIRGRVLHDGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHRNARLCFVHTVPWDQLFQNPHQALLHSANRPEDECVGEGLA
CYPLCAQGHCWGPGPTQCVNCSQFLRGQECVEVLQGLPREYVKDRYCLPCHPECHPQNGS
VTCFGSEADQCVACAHYKDPPFCVARCPSGVKPDLSFMPIWKFPDEEGICQPCPINCTHS
CVDLDDKGCPAEQRASPVTSIIAAVVGVLLVVLVGLVFGILIKRRRQKIRKYTMRRLLQE
TELVEPLTPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIK
VLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREH
RGRLGSQDLXXWCVQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDID
ETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPD
LLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVAEFSRMARDPQRFVVIQNED
MGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAAGTAHRRHRSTSTR
SGGGELTLGLEPSEEEPPRSPLAPSEGAGSDVFDGDLGMGAAKGLQPLPQHDSSPLQRYS
EDPTVPLSPEADGYVAPLTCSPQPEYVNQPEVHPQPPSPLEGPLPPPRPAGSTLERPKTL
SPGKNGVVKDVFAFGAAVENPEYLAPRGRAAPQSHPSPAFSPAFDNLYYWDQDPSERGTP
PSTFEGTPTAENPEYLGLDMPV
NT seq 3669 nt   +upstreamnt  +downstreamnt
atgaagctgcggctgccggccagtcccgagacccacctggacatgctgcgccacctctac
caaggctgtcaggtggtgcagggtaacctggagctcacctatctgcctgctgatgccagc
ctctccttcctgcaggaaatccaggaggtgcagggctatgtgctcatcgctcacaatcaa
gtgagtcaggtcccactgcagagactgcgaatcgtgcgaggcacccagctttttgaggaa
cactacgccctggccgtgctggacaatggagactttctggaaagtgctgcccctgctgca
ggcacagccccaggagggctgcaggagctgcagctgcgaagcctcacagagatcctcaag
ggaggggtcttgatccagcggaacccccagctctgccaccaggacacgattttgtgggag
gatatcttccacaagaacaaccagctgcccctcaagcagatagacaccaaccgctcacgg
gcctgcgcaccctgttctccagcttgtaaagctcccaactgctggggagaaagttctcag
gactgtcagagcttgacgcggaccgtctgtgccagtggctgtgcccgctgtaagggccca
cagcccaccgactgctgccatgagcagtgcgctgctggctgtactggccccaagcactct
gactgcctggcctgcctccacttcaaccacagtggcatctgcgagctgcactgcccagct
ctggtcacctacaacacagacaccttcgagtccatgcccaaccccgaggggcgttatacc
ttcggtgccagctgtgtgacggcctgtccttacaactatctgtctacggatgtgggatcc
tgcaccctggtttgtcccctgaacaaccaagaggtgacagctgaggatggaacccagagg
tgtgagaaatgcagcaagccctgtgccccagtgtgctatggtctgggcatggaacacctg
cgggaggtgagggcggtcaccagtgccaacatccaggagtttgccggctgcaagaagatt
tttgggagcctggcgtttctgccagagagctttgcaggggacccagactctaacatcgcc
ccgctgcaggctgagcagctcaaagtgtttgagtctctggaggagatcacaggttacctg
tacatctcagcgtggccagacagcctgcctgacctcagcgtcttccagaacctgcgagta
atccggggacgagttctgcatgatggtgcctactcgctgaccctgcaagggctgggcatc
agctggctggggctgcgctcgctgcgggaactgggcagcgggctggccctcattcaccgc
aacgcccgcctctgcttcgtacacacggtgccctgggaccagctcttccagaacccccac
caggctctgctccacagcgccaacaggccagaggatgagtgcgtgggcgagggcctggcc
tgctatccactgtgcgcccaagggcactgctggggtcccgggcccacccagtgcgtcaac
tgcagccagttccttcggggccaggaatgcgtggaggtactgcaggggctcccccgggag
tacgtgaaggacaggtactgtctgccgtgccaccccgagtgtcatccccagaatggctca
gtgacctgctttggctcggaggctgaccaatgtgtggcttgtgcccactacaaggatcct
cccttctgcgtggctcgctgccccagtggtgtgaagcctgacctctccttcatgcccatc
tggaagtttccagatgaggagggcatatgccagccatgccccatcaactgcacgcactcc
tgtgtggacttggatgacaagggctgccccgccgagcagagagccagccctgtgacatcc
atcattgccgctgtggtgggcgttctgctggttgtccttgtggggctggtgttcggcatc
ctcattaagcgaaggcgccagaagatccggaagtacacgatgcggaggctgctgcaggag
acggagctggtggagcccctgacgcccagcggagcgatgcccaatcaggctcagatgcgg
atcttaaaagagacagagctgaggaaggtgaaggtgctaggatctggagcttttggcacc
gtctacaagggcatctggatccccgatggggaaaatgtgaaaatccccgtggccatcaag
gtgttgagggaaaacacatctcccaaagccaacaaggaaatcttggacgaagcatatgtg
atggctggtgtaggctccccatatgtgtcccgcctcctgggcatctgcctgacatccaca
gtgcagctggtgacacagctgatgccctatggctgcctcttagaccacgttcgagaacac
cgtgggcgcctgggctcccaggacctnnnnnactggtgtgtgcagattgccaaggggatg
agctacttggaggatgtgcggctcgtgcacagggacctggccgcccggaacgtgctggtc
aagagtcccaaccatgtgaagattacagacttcgggctggctcggctgttagacattgac
gagacagagtaccacgcggatgggggcaaggtgcccatcaagtggatggcattggagtcc
attctccggcggcggtttacccaccagagtgacgtgtggagctatggtgtgactgtgtgg
gagctgatgacttttggggccaaaccttatgatgggatcccagcccgggagattcctgac
ctgctggagaagggagaacggctgccccagccccccatctgcaccattgatgtctacatg
atcatggtcaaatgttggatgattgactctgaatgtcggccgaggttccgggagttagtg
gctgaattctcccgcatggccagggacccccagcgctttgtggtcatccagaatgaagac
atggggcctgctagccccctggatagcaccttctaccgctcgctgctggaggatgacgac
atgggcgacctggtggatgcggaggagtacctggtaccccagcagggcttcttctgccca
gaccctgccccgggtgctgcaggcacggcccatcgcaggcaccgcagcacatccaccagg
agtggcggtggtgagctgacactggggctggagccctctgaggaggagcctcccagatct
ccgctggcaccttccgaaggggcaggctctgatgtgtttgatggtgacttgggaatgggg
gcggccaagggactgcagcccctcccccaacatgactctagtcctctgcagcggtacagc
gaggaccccacagtacccctttctcccgaggctgatggctacgttgcccccttgacctgc
agcccccagccggaatatgtgaaccagccagaggttcacccacagcccccctcaccccta
gagggtcctctgccgcctcctcgacctgctggttccactctggaaaggcccaagacgcta
tcccctgggaagaatggggttgtcaaagacgtttttgcctttggggctgccgtggagaac
cctgagtacttggcaccccggggcagggctgcccctcagtcccacccttctccagccttc
agcccagcctttgacaacctctattattgggaccaggacccatcagagcggggcactcca
cccagcacctttgaagggacccctacggcagagaaccctgagtacttgggtctggacatg
ccagtatga

DBGET integrated database retrieval system