KEGG   Bos mutus (wild yak): 102268077
Entry
102268077         CDS       T02919                                 

Gene name
CCND3
Definition
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04390  Hippo signaling pathway
bom04510  Focal adhesion
bom04630  JAK-STAT signaling pathway
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102268077 (CCND3)
   04390 Hippo signaling pathway
    102268077 (CCND3)
   04630 JAK-STAT signaling pathway
    102268077 (CCND3)
   04151 PI3K-Akt signaling pathway
    102268077 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102268077 (CCND3)
   04115 p53 signaling pathway
    102268077 (CCND3)
   04218 Cellular senescence
    102268077 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102268077 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268077 (CCND3)
   05203 Viral carcinogenesis
    102268077 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102268077 (CCND3)
   05164 Influenza A
    102268077 (CCND3)
   05162 Measles
    102268077 (CCND3)
   05169 Epstein-Barr virus infection
    102268077 (CCND3)
   05165 Human papillomavirus infection
    102268077 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 102268077
NCBI-ProteinID: XP_014335025
LinkDB
Position
Un
AA seq 242 aa
MKSAGGSRWSLLPSFWVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLA
SKLRETTPLTIEKLCIYTDHSVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLALILHRLSL
PRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSTSGDELTELLA
GITGTEVDCLRACQEQIEAALRESLREAAQTSPSPAPKAPRGSSSQGPSQTSTPTDVTAI
HL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaaaagtgcgggaggcagccgctggagtctcctcccttccttttgggtgtgtgaggag
cagcgctgtgaagaggaagtcttccccctggccatgaactacctggatcgctacctgtcc
tgcgtccccacccgaaaggcgcagttgcagctcctgggtgcggtctgcatgctgctggcc
tccaagctgcgcgagactacgcccctgaccatcgaaaaactgtgcatctacaccgaccac
tctgtctctccccgccagctgcgggattgggaggtgctggtcttggggaagctcaagtgg
gacctggccgcagtgattgcccatgatttcctggccctgattctgcaccggctctctctg
ccccgcgaccgacaagccttggtcaagaagcacgcccagacctttttggccctctgtgct
acagactacacctttgccatgtaccccccatccatgattgccacaggcagcatcggagct
gcagtgcaaggcctgggtgcctgctccacatctggggacgagctcacggagctgctggca
gggatcacaggcactgaagtggactgcctgcgggcctgtcaggagcagattgaagctgcc
ctcagggagagcctcagggaagccgcccagacctctcccagcccagcgcccaaagccccc
aggggctccagcagccaggggcccagccagaccagcactcctacagacgtcacggccatc
cacctgtag

KEGG   Bos mutus (wild yak): 102270546
Entry
102270546         CDS       T02919                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04340  Hedgehog signaling pathway
bom04371  Apelin signaling pathway
bom04390  Hippo signaling pathway
bom04510  Focal adhesion
bom04530  Tight junction
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04921  Oxytocin signaling pathway
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05216  Thyroid cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102270546 (CCND1)
   04340 Hedgehog signaling pathway
    102270546 (CCND1)
   04390 Hippo signaling pathway
    102270546 (CCND1)
   04371 Apelin signaling pathway
    102270546 (CCND1)
   04630 JAK-STAT signaling pathway
    102270546 (CCND1)
   04068 FoxO signaling pathway
    102270546 (CCND1)
   04151 PI3K-Akt signaling pathway
    102270546 (CCND1)
   04152 AMPK signaling pathway
    102270546 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102270546 (CCND1)
   04115 p53 signaling pathway
    102270546 (CCND1)
   04218 Cellular senescence
    102270546 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102270546 (CCND1)
   04530 Tight junction
    102270546 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102270546 (CCND1)
   04921 Oxytocin signaling pathway
    102270546 (CCND1)
   04919 Thyroid hormone signaling pathway
    102270546 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102270546 (CCND1)
   05206 MicroRNAs in cancer
    102270546 (CCND1)
   05205 Proteoglycans in cancer
    102270546 (CCND1)
   05203 Viral carcinogenesis
    102270546 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102270546 (CCND1)
   05212 Pancreatic cancer
    102270546 (CCND1)
   05225 Hepatocellular carcinoma
    102270546 (CCND1)
   05226 Gastric cancer
    102270546 (CCND1)
   05214 Glioma
    102270546 (CCND1)
   05216 Thyroid cancer
    102270546 (CCND1)
   05221 Acute myeloid leukemia
    102270546 (CCND1)
   05220 Chronic myeloid leukemia
    102270546 (CCND1)
   05218 Melanoma
    102270546 (CCND1)
   05219 Bladder cancer
    102270546 (CCND1)
   05215 Prostate cancer
    102270546 (CCND1)
   05213 Endometrial cancer
    102270546 (CCND1)
   05224 Breast cancer
    102270546 (CCND1)
   05222 Small cell lung cancer
    102270546 (CCND1)
   05223 Non-small cell lung cancer
    102270546 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102270546 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102270546 (CCND1)
   04934 Cushing syndrome
    102270546 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102270546 (CCND1)
   05160 Hepatitis C
    102270546 (CCND1)
   05162 Measles
    102270546 (CCND1)
   05163 Human cytomegalovirus infection
    102270546 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102270546 (CCND1)
   05169 Epstein-Barr virus infection
    102270546 (CCND1)
   05165 Human papillomavirus infection
    102270546 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102270546 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102270546
NCBI-ProteinID: XP_014338118
LinkDB
Position
Un
AA seq 260 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLGPGAPSLNPLASLSPPATDVKFISNPPSMVAAGSVAAAAQGL
HLGSANGFLSYHRLTRFLSKVIRCDPDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEE
EEEEEVDLACTPTDVRDVNI
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaatgaccgagtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatttacactgacaactccatccggcccgacgagctgctgggtccc
ggggcgccctcactcaacccccttgcctctctgtctccccctgccacagacgtgaagttc
atttccaacccgccctccatggtggccgccgggagcgtggcggccgcggctcaaggcctg
catctgggaagcgccaacggcttcctctcctatcaccgcctgacgcggttcctctccaag
gtgatcagatgtgacccggactgcctccgcgcctgccaggagcagatcgaagccctcctg
gagtccagcctgcgccaggcccagcagcagaacttggaccccaaagccgcggaggaggaa
gaggaggaggaggaggtggacctggcctgcacgcccaccgacgtgcgtgacgtgaacatc
tga

KEGG   Bos mutus (wild yak): 102272576
Entry
102272576         CDS       T02919                                 

Gene name
CCND2
Definition
(RefSeq) cyclin D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04068  FoxO signaling pathway
bom04110  Cell cycle
bom04115  p53 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04218  Cellular senescence
bom04310  Wnt signaling pathway
bom04340  Hedgehog signaling pathway
bom04390  Hippo signaling pathway
bom04510  Focal adhesion
bom04630  JAK-STAT signaling pathway
bom04917  Prolactin signaling pathway
bom05162  Measles
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05203  Viral carcinogenesis
bom05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102272576 (CCND2)
   04340 Hedgehog signaling pathway
    102272576 (CCND2)
   04390 Hippo signaling pathway
    102272576 (CCND2)
   04630 JAK-STAT signaling pathway
    102272576 (CCND2)
   04068 FoxO signaling pathway
    102272576 (CCND2)
   04151 PI3K-Akt signaling pathway
    102272576 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102272576 (CCND2)
   04115 p53 signaling pathway
    102272576 (CCND2)
   04218 Cellular senescence
    102272576 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102272576 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102272576 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102272576 (CCND2)
   05202 Transcriptional misregulation in cancer
    102272576 (CCND2)
   05206 MicroRNAs in cancer
    102272576 (CCND2)
   05203 Viral carcinogenesis
    102272576 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272576 (CCND2)
   05162 Measles
    102272576 (CCND2)
   05169 Epstein-Barr virus infection
    102272576 (CCND2)
   05165 Human papillomavirus infection
    102272576 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 102272576
NCBI-ProteinID: XP_005898002
LinkDB
Position
Un
AA seq 285 aa
MELLCGEVEPVRRAVPDANLLHDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAINYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKH
AQTFIALCATDFKFAMYPPSMIAXXXXXXXXXDEDVSSLTGDALVDLLAKITNTDVDCLK
ACQEQIEVVLLNSLQQYRQDQGDGSKSEDELDQASTPTDVRDIDL
NT seq 858 nt   +upstreamnt  +downstreamnt
atggagctgctgtgcggcgaggtggagccggtccgcagggccgtgccggacgccaacctg
ctccacgacgaccgcgtgttgcagaacttgctgaccatcgaggagcgctacctgccccag
tgctcctacttcaagtgcgtgcagaaggacattcagccctacatgcgcaggatggtggcc
acctggatgctggaggtctgtgaggagcagaagtgcgaagaggaggtctttcctctcgcc
atcaattacctggaccgcttcttggccggagtcccaactccgaagacccatctgcagctg
ctgggggccgtgtgcatgttcctggcgtccaagctcaaagagaccatcccgctgaccgct
gagaagttatgcatttacaccgacaactccatcaagcctcaggagctgctggagtgggag
ctggtggtgctgggcaagttgaaatggaacctggcggctgtcaccccccacgacttcatc
gaacacatccttcgcaagctgcctcagcccagcgagaagctgtcgctgattcgcaagcac
gcccagaccttcatcgctctgtgcgccactgacttcaagttcgccatgtacccgccgtcg
atgattgcannnnnnnnnnnnnnnnnnnnnnnnnaggatgaggatgtgagctcgctcact
ggagacgccctggtggatctcctggcaaagatcaccaacaccgatgtggattgcctcaaa
gcctgccaggagcagattgaggtggtgctgctgaatagcctgcagcagtaccgtcaggac
cagggcgatggatccaagtcggaggatgagctggaccaagccagcacccctacagatgtt
cgggatatcgacctgtga

DBGET integrated database retrieval system