KEGG   Bos mutus (wild yak): 102268108
Entry
102268108         CDS       T02919                                 

Gene name
GAB2
Definition
(RefSeq) GRB2 associated binding protein 2
  KO
K08091  GRB2-associated-binding protein 2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04014  Ras signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04380  Osteoclast differentiation
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102268108 (GAB2)
   04072 Phospholipase D signaling pathway
    102268108 (GAB2)
   04071 Sphingolipid signaling pathway
    102268108 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    102268108 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    102268108 (GAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102268108 (GAB2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102268108 (GAB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bom04990]
    102268108 (GAB2)
Domain-containing proteins not elsewhere classified [BR:bom04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   102268108 (GAB2)
SSDB
Motif
Pfam: PH PH_9 PH_2 PH_11 PH_13
Other DBs
NCBI-GeneID: 102268108
NCBI-ProteinID: XP_005908103
LinkDB
Position
Un
AA seq 640 aa
MSGDPDVLEYYKNDHSKKPLRIINLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLV
AETEEDMNKWVQSICQICGFNQAEESTDSLRNISSAPHGPRSSPAELSSSSQHLLRERKA
SAPSHSSQPTLFTFEPALSNHVQPALSASAPQEYLYLHQCISRRAESTRSASFSQGSRAS
FLMRSDTAVQKLAQGNGHCVNGVGGQVHGFYSLPKPSRHNTEFRDSAYDLPRSLAAHGHT
KGSLTGSETDNEDVYTFKTPSSTLCREFGDLLVDNVDVPTTPLSAYQIPRTFTLDKNHNA
MAVATPGDSAIAPPPRPPKPSQADTPRWGSPQQRPPTGEGSRSVSAAATIPRRNTLPAMD
NSRLHRASSCESYDYPQRGGDSAGRSAESMSDAVSAFLPAKAVVGRSDSTNSEDNYVPMN
PGSSTLLALERAGDNSQSVYIPMSPGPHHFDPLGYPSSALSLHRGSSRGSEIQPPPVNRN
LKPDRKAKPTPLDLRNNTVIDELPFKSPITRSWSRAIHSFSPSSSQYCRPISTQSITSTD
SGDSEENYVPMQNPVSASPIPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVT
SDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPSKGAKL
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgagcggtgaccccgacgtcctggaatactacaagaacgatcactccaagaagcccctg
cgcatcatcaacctgaacttctgcgagcaggtggatgcaggcctgaccttcaacaagaag
gagctgcaggacagcttcgtgttcgacatcaagaccagcgagcgcaccttctacctggtg
gccgagacggaggaggacatgaataagtgggtccagagcatctgccagatctgcggcttc
aaccaggcagaagagagcacagactccctgcggaacatctcctcggccccgcacgggccg
cgctcctctccagcggagctcagcagctccagccagcaccttctccgagagcggaaagcc
tcggccccgtcgcactccagccagccgaccctgttcaccttcgagcccgcgctgtccaac
cacgtgcagcccgccctgtccgccagcgcgcctcaggagtacctctatctgcaccagtgc
atcagccgcagggcggagagcacacggagtgccagcttctctcagggctccagggcctcg
ttcctcatgaggagcgacacagctgtgcagaaacttgcccagggcaacgggcactgtgtc
aacggggtcggtggtcaagtccacggcttctacagcctcccgaagccaagccggcacaac
acagagttcagagacagtgcctacgacctccccaggagcctggccgcccacggccacacc
aagggcagcctcaccggctccgagacagacaacgaggatgtgtataccttcaagacgccc
agcagcaccctgtgccgggagtttggggacctcctggtggacaacgtggacgttccaacc
accccgctctcggcctaccagatccctaggacgttcacgctggacaagaaccacaacgcc
atggcagtggccacgcctggggactcggccatagctcccccgccccggccccccaagccg
agtcaggcagacacacctcgatggggcagccctcagcagagacctcccaccggggaaggc
agcagatcggtctctgccgccgccaccatccccaggcgtaacaccctcccagccatggac
aacagccggcttcaccgagcttcctcctgcgagtcctacgactacccgcagcgtggtgga
gacagtgccggccggtctgccgagtccatgagcgatgcagtcagcgctttcctgccagca
aaagcagtcgtgggtcgatcagacagcaccaattccgaggacaactacgtgcccatgaac
ccaggctcctccaccctgctggctttggagcgagccggtgataactcccagagtgtctac
atccccatgagccccgggccgcaccactttgacccgctcggctacccctcctcagccctc
tctctgcaccgaggctccagcagagggagtgagatccagccaccccctgtcaaccgcaac
ctcaaacctgaccggaaggcaaagccaacaccacttgacctgagaaacaacaccgtcatc
gatgagctccccttcaagtcccccatcaccaggtcttggtccagggccatccactccttc
agccccagctcttcccagtactgccgccccatctctacacagagcatcaccagcaccgac
tccggagacagtgaagagaactacgtccctatgcaaaaccccgtgtctgcatctcccatt
cccagcggcaccaacagcccagcccctaagaagagcactggcagtgtggattatctggcc
ctggacttccagccgagctccccgagcccccaccgcaagccatccacatcatcggtcact
tccgacgagaaggtggactacgttcaagtggacaaggagaagacccaggccctgcagaat
accatgcaggagtggacagacgtgcggcagtcctcggagccctccaagggcgcaaagctg
tga

DBGET integrated database retrieval system