KEGG   Bos mutus (wild yak): 102268124
Entry
102268124         CDS       T02919                                 

Gene name
CXCL8, IL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
bom  Bos mutus (wild yak)
Pathway
bom04060  Cytokine-cytokine receptor interaction
bom04061  Viral protein interaction with cytokine and cytokine receptor
bom04062  Chemokine signaling pathway
bom04064  NF-kappa B signaling pathway
bom04072  Phospholipase D signaling pathway
bom04218  Cellular senescence
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05132  Salmonella infection
bom05133  Pertussis
bom05134  Legionellosis
bom05135  Yersinia infection
bom05142  Chagas disease
bom05144  Malaria
bom05146  Amoebiasis
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05171  Coronavirus disease - COVID-19
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05219  Bladder cancer
bom05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102268124 (CXCL8)
   04072 Phospholipase D signaling pathway
    102268124 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102268124 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102268124 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102268124 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102268124 (CXCL8)
   04621 NOD-like receptor signaling pathway
    102268124 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    102268124 (CXCL8)
   04657 IL-17 signaling pathway
    102268124 (CXCL8)
   04062 Chemokine signaling pathway
    102268124 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268124 (CXCL8)
   05202 Transcriptional misregulation in cancer
    102268124 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    102268124 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102268124 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102268124 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102268124 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102268124 (CXCL8)
   05135 Yersinia infection
    102268124 (CXCL8)
   05133 Pertussis
    102268124 (CXCL8)
   05134 Legionellosis
    102268124 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102268124 (CXCL8)
   05171 Coronavirus disease - COVID-19
    102268124 (CXCL8)
   05164 Influenza A
    102268124 (CXCL8)
   05163 Human cytomegalovirus infection
    102268124 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102268124 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102268124 (CXCL8)
   05144 Malaria
    102268124 (CXCL8)
   05142 Chagas disease
    102268124 (CXCL8)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Chemokines
   102268124 (CXCL8)
Glycosaminoglycan binding proteins [BR:bom00536]
 Heparan sulfate / Heparin
  Chemokines
   102268124 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102268124
NCBI-ProteinID: XP_005891308
UniProt: L8IU99
LinkDB
Position
Un
AA seq 101 aa
MTSKLAVALLAAFLLSAALCEAAVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPH
CENSEIIVKLTNGKEVCLNPKEKWVQKVVQVFVKRAEKQDP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggcagctttcctgctctctgcagctctgtgt
gaagctgcagttctgtcaagaatgagtacagaacttcgatgccaatgcataaaaacacat
tccacacctttccaccccaaatttatcaaagaattgagagttattgagagtgggccacac
tgtgaaaattcagaaatcattgttaagcttaccaatggaaaagaggtctgcttaaacccc
aaggaaaagtgggtgcagaaggttgtgcaggtatttgtgaagagagctgagaagcaagat
ccatga

DBGET integrated database retrieval system