Bos mutus (wild yak): 102268124 Help Entry 102268124         CDS       T02919                                  Gene name CXCL8, IL8 Definition (RefSeq) C-X-C motif chemokine ligand 8   KO K10030   interleukin 8 Organism bom  Bos mutus (wild yak) Pathway bom04060   Cytokine-cytokine receptor interaction bom04061   Viral protein interaction with cytokine and cytokine receptor bom04062   Chemokine signaling pathway bom04064   NF-kappa B signaling pathway bom04072   Phospholipase D signaling pathway bom04218   Cellular senescence bom04620   Toll-like receptor signaling pathway bom04621   NOD-like receptor signaling pathway bom04622   RIG-I-like receptor signaling pathway bom04657   IL-17 signaling pathway bom04932   Non-alcoholic fatty liver disease bom04933   AGE-RAGE signaling pathway in diabetic complications bom05132   Salmonella infection bom05133   Pertussis bom05134   Legionellosis bom05135   Yersinia infection bom05142   Chagas disease bom05144   Malaria bom05146   Amoebiasis bom05161   Hepatitis B bom05163   Human cytomegalovirus infection bom05164   Influenza A bom05167   Kaposi sarcoma-associated herpesvirus infection bom05171   Coronavirus disease - COVID-19 bom05200   Pathways in cancer bom05202   Transcriptional misregulation in cancer bom05219   Bladder cancer bom05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:bom00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102268124 (CXCL8)    04072 Phospholipase D signaling pathway     102268124 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102268124 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102268124 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102268124 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102268124 (CXCL8)    04621 NOD-like receptor signaling pathway     102268124 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102268124 (CXCL8)    04657 IL-17 signaling pathway     102268124 (CXCL8)    04062 Chemokine signaling pathway     102268124 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102268124 (CXCL8)    05202 Transcriptional misregulation in cancer     102268124 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102268124 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102268124 (CXCL8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102268124 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102268124 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102268124 (CXCL8)    05135 Yersinia infection     102268124 (CXCL8)    05133 Pertussis     102268124 (CXCL8)    05134 Legionellosis     102268124 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102268124 (CXCL8)    05171 Coronavirus disease - COVID-19     102268124 (CXCL8)    05164 Influenza A     102268124 (CXCL8)    05163 Human cytomegalovirus infection     102268124 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102268124 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102268124 (CXCL8)    05144 Malaria     102268124 (CXCL8)    05142 Chagas disease     102268124 (CXCL8) Cytokines and growth factors [BR:bom04052]  Cytokines   Chemokines    102268124 (CXCL8) Glycosaminoglycan binding proteins [BR:bom00536]  Heparan sulfate / Heparin   Chemokines    102268124 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102268124 NCBI-ProteinID:  XP_005891308 UniProt:  L8IU99 LinkDB All DBs Position Un AA seq 101 aa AA seqDB search MTSKLAVALLAAFLLSAALCEAAVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPH CENSEIIVKLTNGKEVCLNPKEKWVQKVVQVFVKRAEKQDP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgctctcttggcagctttcctgctctctgcagctctgtgt gaagctgcagttctgtcaagaatgagtacagaacttcgatgccaatgcataaaaacacat tccacacctttccaccccaaatttatcaaagaattgagagttattgagagtgggccacac tgtgaaaattcagaaatcattgttaagcttaccaatggaaaagaggtctgcttaaacccc aaggaaaagtgggtgcagaaggttgtgcaggtatttgtgaagagagctgagaagcaagat ccatga

DBGET integrated database retrieval system