KEGG   Bos mutus (wild yak): 102268170
Entry
102268170         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102268170
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102268170
   04145 Phagosome
    102268170
  09143 Cell growth and death
   04218 Cellular senescence
    102268170
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102268170
   04612 Antigen processing and presentation
    102268170
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102268170
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102268170
   05330 Allograft rejection
    102268170
   05332 Graft-versus-host disease
    102268170
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102268170
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102268170
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102268170
   05170 Human immunodeficiency virus 1 infection
    102268170
   05168 Herpes simplex virus 1 infection
    102268170
   05163 Human cytomegalovirus infection
    102268170
   05167 Kaposi sarcoma-associated herpesvirus infection
    102268170
   05169 Epstein-Barr virus infection
    102268170
   05165 Human papillomavirus infection
    102268170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102268170
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102268170
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102268170
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102268170
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C MHC_I_3 C2-set_2 ig Ig_2 stn_TNFRSF12A
Other DBs
NCBI-GeneID: 102268170
NCBI-ProteinID: XP_014335839
LinkDB
Position
Un
AA seq 372 aa
MGRRILLLLVLGVLVLTETRAGFHSLRYFYTAVSRPGLGEPRFIAVGYVDDTQFVRFDSD
AANPREEPRAPWMEQEGPEYWDRNTRIYKDTAQNFRVGLNNLRGYYDQSEAGEQXXXXMS
GCDVGPDGRLLRGFMQFAYDGRDYIALNEDLSSWTAADTTDTAAQISKRKVEAAGSAESG
RKYVEGTCVEWLRRYLENGKDTLLQAYPPKAHVTHHPISDREVTLRCWALGFYPEEISLT
WQRNGEDQTQDMELVETRPSGDGNFQKWAALGVPSGEEQRYTCRVQHEGLQGPLPLSWVR
APSLSSTEPPQPSFLTMGIIVGLVLLVVTGAVVAGVLIWRKKHSGEKGWTYTQASGNDSA
QGSDVSLMVLKV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggggcggcgaatcctcctcctgctcgtgttgggggtcctggtcctgaccgagacccgg
gcgggcttccactccctgaggtatttctacaccgctgtgtcccggcccggcctcggggag
ccgcgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttcgacagcgac
gccgcgaatccaagggaagaaccgcgggctccgtggatggagcaggaggggccggagtat
tgggatcgaaacacgagaatctacaaggacaccgcacagaatttccgagtgggcctgaac
aacctgcgcggctattacgaccagagcgaagccggtgagcaannnnnnnnnnnnatgtcc
ggctgcgacgtggggccggatgggcgcctcctccgcgggttcatgcagttcgcctacgac
ggcagagattacatcgccctgaacgaggacctgagctcctggaccgcagcggacacgacg
gacacggcggctcagatctccaagcgcaaggtggaggcggcaggttctgcggagagcggg
aggaagtacgtggagggcacgtgcgtggagtggctccgcagatacctggagaacgggaag
gacactctgctgcaggcttaccctccaaaggcacatgtgacccatcaccccatctctgac
cgtgaggtcaccctgaggtgctgggccctgggcttctaccctgaggagatctcactgacc
tggcaacgcaatggggaggaccagacccaggacatggagcttgtggagaccaggccttca
ggggatggaaacttccagaagtgggcagccctgggggtgccttctggagaggagcagaga
tacacgtgccgtgtgcagcacgaggggcttcaggggcccctccccctgagctgggtcagg
gccccttccctttcttccacagaacctcctcagccctccttcctcaccatgggcatcatt
gttggcctggttctcctcgtggtcactggagctgtggtggctggagttctgatctggagg
aagaagcactcaggtgaaaaaggatggacctacacccaggcttcaggcaatgacagtgcc
cagggctctgatgtgtctctcatggttcttaaagtgtga

KEGG   Bos mutus (wild yak): 102270654
Entry
102270654         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102270654
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102270654
   04145 Phagosome
    102270654
  09143 Cell growth and death
   04218 Cellular senescence
    102270654
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102270654
   04612 Antigen processing and presentation
    102270654
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102270654
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102270654
   05330 Allograft rejection
    102270654
   05332 Graft-versus-host disease
    102270654
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102270654
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102270654
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102270654
   05170 Human immunodeficiency virus 1 infection
    102270654
   05168 Herpes simplex virus 1 infection
    102270654
   05163 Human cytomegalovirus infection
    102270654
   05167 Kaposi sarcoma-associated herpesvirus infection
    102270654
   05169 Epstein-Barr virus infection
    102270654
   05165 Human papillomavirus infection
    102270654
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102270654
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102270654
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102270654
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102270654
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 Ig_3 Ig_2 ig EphA2_TM PTP_tm FAM176
Other DBs
NCBI-GeneID: 102270654
NCBI-ProteinID: XP_014338495
LinkDB
Position
Un
AA seq 314 aa
MRVMGPRTLLLLLSGVLVLNETRAGSHSLRYFLTAVSRPDLGEPRYLEVGYVDNTQFVRF
DRDXXXXXXXXXXXVEQEGPEYWDQNTRNSKGAAQTFRVDLNTLRGYYNQSEAGSHTIQA
MYGCDVGPDGRFLRGYRQDAYDGRDYIALYEDTLLRADPPKAHVTHHPISDREVTLRCWA
LGFYPEEISLTWQRNGEDQTQDMELVETRPSGDGNGSFQKWAALVVPSGEEQRYTCRVQH
KGLQEPLTLIWEPPQPSVPIMGIVVGLVLLLVAVVAGAVIWRKKCSGEKGQTYTQAASSD
SDQGSDVSRTVPKV
NT seq 945 nt   +upstreamnt  +downstreamnt
atgcgagtcatggggcctcgaaccctcctcctgctgctttcgggggtcttggtcctgaac
gagacccgggctggctcccactccctgaggtatttcctcaccgccgtgtcccggcccgac
ctcggggagccccggtacctggaagtcggctacgtggacaacacgcagttcgtgcggttc
gacagggacnnnnnnnnnnnnnnnnnnnnnnnnnnnnntngtgtggagcaggaggggccg
gagtattgggatcagaacacgcgaaactccaagggcgccgcacagactttccgagtggac
ctgaacaccctgcgcggctactacaaccagagcgaggccgggtctcacactatccaggcg
atgtacggctgcgacgtggggccggacgggcgtttcctccgcgggtacaggcaggacgct
tacgacggcagagattacatcgccctgtacgaggacactctgctgcgcgcagaccctcca
aaggcacatgtgacccatcaccccatctctgaccgtgaggtcaccctgaggtgctgggcc
ctgggcttctaccctgaggagatctcactgacctggcagcgcaatggggaggaccagacc
caggacatggagcttgtggagaccaggccttcaggggatggaaacggaagcttccagaag
tgggcagccctggtggtgccttctggagaggagcagagatacacgtgccgtgtgcagcac
aaagggcttcaggagcccctcaccctgatatgggaacctcctcagccctccgtccccatc
atgggcatcgttgttggcctggttctcctcctggtggctgtagtggctggagctgtgatc
tggaggaagaagtgctcaggtgaaaaaggacagacctacactcaggctgcaagcagtgac
agtgaccagggctctgatgtgtctcgcacggttcctaaagtgtga

KEGG   Bos mutus (wild yak): 102272326
Entry
102272326         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102272326
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102272326
   04145 Phagosome
    102272326
  09143 Cell growth and death
   04218 Cellular senescence
    102272326
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102272326
   04612 Antigen processing and presentation
    102272326
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102272326
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102272326
   05330 Allograft rejection
    102272326
   05332 Graft-versus-host disease
    102272326
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102272326
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102272326
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102272326
   05170 Human immunodeficiency virus 1 infection
    102272326
   05168 Herpes simplex virus 1 infection
    102272326
   05163 Human cytomegalovirus infection
    102272326
   05167 Kaposi sarcoma-associated herpesvirus infection
    102272326
   05169 Epstein-Barr virus infection
    102272326
   05165 Human papillomavirus infection
    102272326
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102272326
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102272326
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102272326
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102272326
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 102272326
NCBI-ProteinID: XP_005906994
LinkDB
Position
Un
AA seq 353 aa
MLWGPVLLYFFLAYLPETQTRSHSLQYFYSVVSEPGPGVPSFMAFGFVDNQPFIRYDSEE
MKAKSCVHWLREEPSYFDDETKIFTSRMKIFHLNLRNVQQYYNQTKEDGLNRALAQKQTS
PHTLQFTYGCELLEDGRTTWHWQYGYDGEDYLSLHMDPLQYTAATFVAQYTKQKWEAGGN
FIERDKNYLEKECILWLWRYLTFGGESLNRTEPPKTHMTHHRISDREVTLRCWALGFYPA
KISLTWQRNGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQKYTCRVQHEGLQEPLT
LRWEPLKTSVPITGIIVVLVLLVVTRAVIWIKKLSGYYHSTNGKNRTYFQTAI
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctgtggggccctgtcctcttgtatttcttcctagcatacctgccagagacacaaacc
cgatcacactctctgcagtatttctactcagttgtgtctgaaccgggtccaggagtccct
tcatttatggcttttggcttcgtggacaaccagcccttcattcgctatgacagtgaagag
atgaaggcaaagtcttgtgttcattggttgagggaggagccaagttactttgatgatgag
accaagatcttcacaagtcggatgaagattttccacttaaatctgaggaatgtacagcaa
tattacaaccaaaccaaggaggatggtctgaacagagcgctggcacaaaagcaaacaagc
ccccacaccctccagttcacctacggctgtgagctcctggaggacggcaggaccacgtgg
cactggcagtatggctatgatggtgaggactacctgagcttgcatatggaccctctgcaa
tacacagcagccacattcgttgctcagtacaccaaacaaaaatgggaggccggtgggaac
ttcatagagagagacaagaactacttggagaaggaatgcatcctgtggttgtggagatac
ttgacgtttggaggggagagcttgaaccgcactgagcctcccaaaacacacatgactcat
caccgcatctctgaccgtgaggtcaccctgaggtgctgggccctgggcttctaccctgcg
aagatctcactgacctggcagcgcaatggggaagaccagacccaggacatggagcttgtg
gagaccagaccttcaggagacggaaccttccagaagtgggcggccctggtggtgccttct
ggagaggagcagaaatacacgtgccgtgtgcagcacgaggggcttcaggagcccctcacc
ctgagatgggaacctctgaagacctccgtccccatcacaggcatcattgttgtcctggtt
ctcctcgtggtcactagagctgtgatctggataaagaagctctcaggatattatcactct
acaaatggaaaaaatagaacctactttcagactgcaatctaa

KEGG   Bos mutus (wild yak): 102275624
Entry
102275624         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-6-like
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102275624
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102275624
   04145 Phagosome
    102275624
  09143 Cell growth and death
   04218 Cellular senescence
    102275624
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102275624
   04612 Antigen processing and presentation
    102275624
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102275624
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102275624
   05330 Allograft rejection
    102275624
   05332 Graft-versus-host disease
    102275624
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102275624
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102275624
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275624
   05170 Human immunodeficiency virus 1 infection
    102275624
   05168 Herpes simplex virus 1 infection
    102275624
   05163 Human cytomegalovirus infection
    102275624
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275624
   05169 Epstein-Barr virus infection
    102275624
   05165 Human papillomavirus infection
    102275624
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102275624
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102275624
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102275624
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102275624
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2 EphA2_TM
Other DBs
NCBI-GeneID: 102275624
NCBI-ProteinID: XP_014334282
LinkDB
Position
Un
AA seq 275 aa
MVGAGQGLTPSKNGCDVGSDGGFLRGYDQFAYEGRDYIALNEDLRSWTAADTAAQVTKHN
AEAAGDAARVRIYLEGKCVEWLRRYLVTGKDTLLRADPPKAHVTHHSISDREVTLRCWAL
GFYPEEISLTWQHNGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYMCRVQHEGL
QEPLTLRWEPPQPSFLTMGIIVGLVLLVVTGAVVAGVVVCMKKRSGEKGRIYTQAGSSDS
SRGHFACHCPHKSKGTMHTGFSVVRIFRAIQLFSF
NT seq 828 nt   +upstreamnt  +downstreamnt
atggtcggggcgggtcagggtctcacaccgtccaagaacggctgcgacgtggggtcggac
gggggtttcctgcgcgggtatgatcagttcgcctacgaaggcagagattacatcgccctg
aacgaggacctgcgctcctggaccgcggcggacacggcggctcaagtcaccaagcacaat
gctgaggcggcaggtgatgcggcgcgtgtgaggatctacctggagggcaagtgcgtggag
tggctccgcagatacctggtgaccgggaaggacacgctgctgcgcgcagaccctccaaag
gcacacgtgacccatcactccatctctgaccgtgaggtcaccctgaggtgctgggccctg
ggcttctaccctgaggagatctcactgacctggcagcacaatggggaggaccagacccag
gacatggagcttgtggagaccaggccttcaggggatggaaccttccagaagtgggctgcc
ctggtggtaccttctggagaggagcagagatacatgtgccgtgtgcagcatgaggggctt
caggagcccctcaccctgagatgggaacctcctcagccctccttcctcaccatgggcatc
attgttggcctggttctcctcgtggtcactggagctgtggtggctggagttgtggtctgc
atgaagaagcgctcaggtgaaaaaggacggatctacacccaggctgggagctctgacagt
agcaggggtcactttgcctgtcactgtccccacaagtccaaggggaccatgcacacagga
ttctcagtggttcggattttcagagccatccagctcttctccttctag

KEGG   Bos mutus (wild yak): 102278231
Entry
102278231         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102278231
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102278231
   04145 Phagosome
    102278231
  09143 Cell growth and death
   04218 Cellular senescence
    102278231
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102278231
   04612 Antigen processing and presentation
    102278231
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102278231
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102278231
   05330 Allograft rejection
    102278231
   05332 Graft-versus-host disease
    102278231
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102278231
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102278231
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102278231
   05170 Human immunodeficiency virus 1 infection
    102278231
   05168 Herpes simplex virus 1 infection
    102278231
   05163 Human cytomegalovirus infection
    102278231
   05167 Kaposi sarcoma-associated herpesvirus infection
    102278231
   05169 Epstein-Barr virus infection
    102278231
   05165 Human papillomavirus infection
    102278231
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102278231
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102278231
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102278231
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102278231
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 Ig_2 C2-set_2 ig MATalpha_HMGbox
Other DBs
NCBI-GeneID: 102278231
NCBI-ProteinID: XP_014333784
LinkDB
Position
Un
AA seq 260 aa
LNEDLRSWTAANTVAQITKRKWETSGEAEFQRNYLEVKCVQWLLRHLETGKDTLLRADPP
KTHVAHHRISDHDITLRCWALGFYPEEISLTWRRDREDQTQDMEFVETRPSGDGIFQKWV
ALVVPSGEEQRYTCCVQHEGLQKPLTLRWEPPQPSIPIMGIMVGRLLMVTGAVVTEAVIW
RKKHSGEVGRGYTQAASSDGAQGSGVPLTVLKGETLGRLKCETAALWGLSDALSHFATSD
PQTPLYAASCECVCAPISIT
NT seq 783 nt   +upstreamnt  +downstreamnt
ctgaacgaagacctgcgctcctggaccgcggcgaacacggtggctcagatcaccaagcgc
aagtgggaaacctccggggaggcagagttccaacggaactacctggaggtcaagtgcgtg
cagtggctcctcagacacctggagacaggaaaggacacgttgctgcgcgcagaccctcca
aagactcatgtggcccatcaccgcatctctgaccatgacatcaccctgaggtgctgggcc
ctgggcttctaccctgaggagatctcactgacctggcggcgtgacagggaggaccagact
caggatatggagtttgtggagaccaggccttcaggggatggaatcttccagaagtgggtg
gccctggtggtgccttccggagaggagcagagatacacgtgctgtgtgcagcatgagggg
ctacagaaacccctcaccctgagatgggaacctcctcagccctccattcccataatgggc
atcatggttggacggctcctcatggtcactggagctgtggtgactgaagctgtgatttgg
aggaagaagcactcaggtgaagtaggaaggggctacactcaggctgcaagcagtgacggt
gcccagggctctggtgtgcctctcacggttcttaaaggtgagaccctggggcgtctaaag
tgtgagacagctgccttgtggggactgagtgatgctctgtcccactttgcaacgtcagat
ccccagaccccactttacgcagcttcgtgtgaatgtgtctgtgctcctattagcataaca
tga

KEGG   Bos mutus (wild yak): 102281193
Entry
102281193         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102281193
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102281193
   04145 Phagosome
    102281193
  09143 Cell growth and death
   04218 Cellular senescence
    102281193
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102281193
   04612 Antigen processing and presentation
    102281193
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102281193
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102281193
   05330 Allograft rejection
    102281193
   05332 Graft-versus-host disease
    102281193
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102281193
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102281193
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102281193
   05170 Human immunodeficiency virus 1 infection
    102281193
   05168 Herpes simplex virus 1 infection
    102281193
   05163 Human cytomegalovirus infection
    102281193
   05167 Kaposi sarcoma-associated herpesvirus infection
    102281193
   05169 Epstein-Barr virus infection
    102281193
   05165 Human papillomavirus infection
    102281193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102281193
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102281193
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102281193
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102281193
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2 MHC_I_3 EphA2_TM FeoB_associated
Other DBs
NCBI-GeneID: 102281193
NCBI-ProteinID: XP_014337372
LinkDB
Position
Un
AA seq 375 aa
PYDPSALPVPSPRTRDARRGEVGPSHPSPLSGPHSMRYFYTAVSRPGLGEPRFIAVGYVD
DTQFVRFDRDAPAPRTWVEDEGPEYWDQETRIQKENTQTFRANLNTLLGYYNQSEAGSHT
IQWMHGCGVGSDGRLLRGYNQHAYDGKDYLALNEDLRSWTAADTAAQITKRKWEAAGEAE
RHRNYLEGTCVEWLRRYLENGKDTLLRADPPKAHVTRHPISGREVTLRCWALGFYPEEIS
LTWQRNGEDQTQDMELVETRPSGDGTFQKWAALAVPSGEEQRYTCHVQHEGLQEPLTLRW
EPPQTPFLTMGIIVGLVLFVVAVVAGAVIWRKKNSGEKGRTYTQASSSDSAQGSDVSLTV
PKAASECICAPISIT
NT seq 1128 nt   +upstreamnt  +downstreamnt
ccctacgacccttccgccctccctgtcccatcacctcggacccgggacgcgcgccgcggg
gaggtcgggccgtctcacccctccccgctctcaggccctcactccatgaggtatttctac
accgccgtgtcccggcccggcctcggggagccccgcttcatcgccgtcggctacgtggac
gacacgcagttcgtgcggttcgaccgcgacgccccggctccgaggacgtgggtggaggat
gaggggccggagtattgggatcaagagacgcggatacaaaaggaaaacacacagactttc
cgagcaaacctgaacaccctactcggctactacaaccagagcgaggccgggtctcacacc
atccagtggatgcacggctgcggcgtggggtcggacgggcgcctcctccgcgggtataat
cagcacgcctatgacggcaaagattacctcgccctgaacgaggacctgcgctcctggacc
gcggcggacacggcggctcagatcaccaagcgcaagtgggaggcggcaggtgaggcggag
agacacaggaactacctggagggcacgtgcgtggagtggctccgcagatacctggagaac
gggaaggacacgctgctgcgcgcagaccctccaaaggcacatgtgacccgtcaccccatc
tctggtcgtgaggtcaccctgaggtgctgggccctgggcttctaccctgaggagatctca
ctgacctggcagcgcaatggggaggaccagacccaggacatggagcttgtggagaccagg
ccttcaggggatggaaccttccagaagtgggcggccctggcggttccttctggagaggag
cagagatacacgtgccatgtgcagcacgaggggcttcaggagcccctcaccctgagatgg
gagcctcctcagacccccttcctcaccatgggcatcattgttggcctggttctcttcgtg
gtggctgtggttgctggagctgtgatctggaggaagaagaactcaggtgaaaaaggacgg
acctacacccaggcttcaagcagtgacagtgcccagggctctgatgtgtctctcacggtt
cctaaagctgcatctgaatgcatctgtgctcctattagcataacatga

KEGG   Bos mutus (wild yak): 102286220
Entry
102286220         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-6
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102286220
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102286220
   04145 Phagosome
    102286220
  09143 Cell growth and death
   04218 Cellular senescence
    102286220
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102286220
   04612 Antigen processing and presentation
    102286220
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102286220
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102286220
   05330 Allograft rejection
    102286220
   05332 Graft-versus-host disease
    102286220
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102286220
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102286220
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286220
   05170 Human immunodeficiency virus 1 infection
    102286220
   05168 Herpes simplex virus 1 infection
    102286220
   05163 Human cytomegalovirus infection
    102286220
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286220
   05169 Epstein-Barr virus infection
    102286220
   05165 Human papillomavirus infection
    102286220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102286220
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102286220
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102286220
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102286220
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig Ig_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 102286220
NCBI-ProteinID: XP_005904273
LinkDB
Position
Un
AA seq 359 aa
MGPRTLLLLLSEVLVLTETWAGSHSLSYFCTCVSRPGLGEPRFFAVGYVDDTQFARFDSD
APNPRMELRAPWMEQEGPEYWEAMTRDAKKAQQRLRTGLNTIRGFYNQSEAGSHTLQWVL
GCDVGPEGRLLRGIWQNAYDGADYLALNEDLRSWTAANTVAQITKRKWETSGEAEFQRNY
LEVKCVQWLLRHLETGKDTLLRADPPKTHVAHHPISDREVTLRCWALGFYPEEISLTWQR
DGEAQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYTCHVQHEGLQEPLSLRWKPPQP
SIPIMGIIVGLVLLMVTGAVVTGAVIWRKKHSGQTGRGYTQAASSDSAQGSDVSLMVPK
NT seq 1078 nt   +upstreamnt  +downstreamnt
atggggccgcgaaccctcctcctgctgctctcggaggtcctggtcctgaccgagacctgg
gcgggctcccactccctgagctatttctgcacctgcgtgtcccggcccggcctcggggag
ccgcgtttctttgccgtcggctacgtggacgacacacagttcgcgcggttcgacagcgac
gccccgaatccgagaatggagctgcgggcgccttggatggagcaggaggggccggaatat
tgggaagcgatgacaagagatgccaagaaagctcaacagagattgcgaacgggcttgaac
accatacgcggtttctacaaccagagcgaggccgggtctcacaccctccagtgggtgctt
ggctgcgacgtggggccggaggggcgcctcctccgcgggatctggcagaacgcctatgac
ggtgcggattacctcgccctgaacgaagacctgcgctcctggaccgcggcgaacacggtg
gctcagatcaccaagcgcaagtgggaaacctccggggaggcagagttccaacggaactac
ctggaggtcaagtgcgtgcagtggctcctcagacacctggagacaggaaaggacacgttg
ctgcgcgcagaccctccaaagacacatgtggcccatcaccccatctctgaccgtgaggtc
accctgaggtgctgggccctgggcttctaccctgaggagatctcactgacctggcagcgt
gacggggaggcccagacccaggacatggagcttgtggagaccaggccttcaggggatgga
accttccagaagtgggcggccctggtggtgccttctggagaagagcagagatacacgtgc
cacgtgcagcacgaggggcttcaggagcccctctccctgagatggaaacctcctcagccc
tccatccccatcatgggcatcattgttggcctggttctcctcatggtcactggagctgtg
gtgactggagctgtgatttggaggaagaagcactcaggtcaaacaggaaggggctacacc
caggctgcaagcagtgacagtgcccagggctctgatgtgtctctcatggttcctaaag

KEGG   Bos mutus (wild yak): 102286791
Entry
102286791         CDS       T02919                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102286791
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102286791
   04145 Phagosome
    102286791
  09143 Cell growth and death
   04218 Cellular senescence
    102286791
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102286791
   04612 Antigen processing and presentation
    102286791
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102286791
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102286791
   05330 Allograft rejection
    102286791
   05332 Graft-versus-host disease
    102286791
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102286791
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102286791
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102286791
   05170 Human immunodeficiency virus 1 infection
    102286791
   05168 Herpes simplex virus 1 infection
    102286791
   05163 Human cytomegalovirus infection
    102286791
   05167 Kaposi sarcoma-associated herpesvirus infection
    102286791
   05169 Epstein-Barr virus infection
    102286791
   05165 Human papillomavirus infection
    102286791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102286791
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102286791
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102286791
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102286791
SSDB
Motif
Pfam: MHC_I_C C1-set MHC_I C2-set_2 Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 102286791
NCBI-ProteinID: XP_014336432
LinkDB
Position
Un
AA seq 211 aa
MRVVGQRTLLLLLLLDALILTETRAGDAARVRIYLEGKCVEWLRRYLVTGKDTLLRADPP
KTHVTHHPISDHEVTLRCWALGFYPDLTWQRNGEDQTQDMELVETRPSGDGTFQKWAALV
VPSGEEQRYTCHVQHEGLQEPLTLRWEPPQPSILIMGIIVGLVLLMVTGAVVTGAVIWRK
KHSGEKGRGYTQTASSYSDQGSDVSLTVPKV
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcgggttgtggggcagagaactctcctcctgctgctgctgctggatgcgctgatcctc
actgagaccagggcgggtgatgccgcgcgtgtgaggatctacctggagggcaagtgtgtg
gagtggctccgcagatacctggtgaccgggaaggacacgctgctgcgcgcagaccctcca
aagacacatgtgacccatcaccccatctctgaccatgaggtcaccttgaggtgctgggcc
ctgggcttctatcccgatctgacctggcagcgcaatggggaagaccagacccaggacatg
gagcttgtggagaccagaccttcaggagacggaaccttccagaagtgggcggccctggtg
gtgccttctggagaggagcagagatacacgtgccatgtgcagcacgaggggcttcaggag
cccctcaccctgagatgggaacctcctcagccctccatcctcatcatgggcatcattgtt
ggcctggttctcctcatggtcactggagctgtggtgactggagctgtgatttggaggaag
aagcactcaggtgaaaaaggaaggggctacacccagactgcaagcagttacagtgaccag
ggctctgatgtgtctctcacggttcctaaagtgtga

KEGG   Bos mutus (wild yak): 102288356
Entry
102288356         CDS       T02919                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain
  KO
K06751  MHC class I antigen
Organism
bom  Bos mutus (wild yak)
Pathway
bom04144  Endocytosis
bom04145  Phagosome
bom04218  Cellular senescence
bom04514  Cell adhesion molecules
bom04612  Antigen processing and presentation
bom04940  Type I diabetes mellitus
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05203  Viral carcinogenesis
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102288356
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102288356
   04145 Phagosome
    102288356
  09143 Cell growth and death
   04218 Cellular senescence
    102288356
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102288356
   04612 Antigen processing and presentation
    102288356
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102288356
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102288356
   05330 Allograft rejection
    102288356
   05332 Graft-versus-host disease
    102288356
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102288356
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102288356
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102288356
   05170 Human immunodeficiency virus 1 infection
    102288356
   05168 Herpes simplex virus 1 infection
    102288356
   05163 Human cytomegalovirus infection
    102288356
   05167 Kaposi sarcoma-associated herpesvirus infection
    102288356
   05169 Epstein-Barr virus infection
    102288356
   05165 Human papillomavirus infection
    102288356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102288356
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
    102288356
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102288356
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bom00537]
 Antigens
  102288356
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3
Other DBs
NCBI-GeneID: 102288356
NCBI-ProteinID: XP_014332272
LinkDB
Position
Un
AA seq 482 aa
MTTVVGDTSRLARRLPSRGSHRGAGGGSQWCDRVPAGSLNLNQDVVAPSAAQRELSAHPP
GTRERTRPALAQLKAAPPGTGALGRCVRLATMWLRSSGSAQHPRPPPPPSLLRLLLLLSG
LVQKGAAESPWGLPSVADGPASMAKVVMAELANLKLENKSWPRGTHSLRYHYLDLSEPDP
SLPKFQAVGYVDDQPFIRYDSRVDKAEPQAPWIMPMNAKYWEKETKKQRKWAELHQVETW
RMMGYHNHSSGMHSTHRMFGCEIQEDGHSNSFWQFGYDGQDHVSLDMETLSWVSANPVAL
LTKRRMETEHCYAEYNKAYLEGPCLASLRRYLELGGQRFTRREPPTVRVTKHSAQDGGTT
LRCWALGFYPQDITLSWWLGEKKLNSKLEYVEARPSGDGTYQTWMAVWVPAGDETQYTCH
VQHCSLNHTLTVSWEMPSHPRLTAVVLSLILILLVIGGGVSLTKCLQARNKEPYEQPPGD
CG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgacgacagtagtcggagacacctctcgacttgccagacggctgcccagcagagggagc
catcgaggagctgggggcgggtcccagtggtgcgatagagtcccagccggaagtctgaac
ctgaaccaggatgtggtcgcaccctccgcggcccagagggagctgagcgctcacccgccg
gggacccgggagcggacgcggccggcgttagcacaactgaaggcggcccccccggggacc
ggcgccctcgggcggtgcgtgaggctggcgaccatgtggcttcgtagttccgggagtgcg
cagcacccgcggccgccgccaccaccctcactgctgcggctgctgctactgctgtcagga
ctggtgcagaagggagcggcagagagtccctgggggttgccctcggtggccgatggccca
gcttccatggcaaaggtggtgatggcagaactggcaaacctgaagttggaaaacaagtca
tggcctagagggacgcactccctccgctaccactacctggacctgtcagagccggacccg
agcctccctaagtttcaggctgtaggctacgtggatgatcagccttttatccggtatgac
agtcgtgtggacaaagctgagccccaggctccatggattatgcccatgaatgccaagtac
tgggagaaggagaccaagaagcagaggaaatgggcagagcttcatcaggtggagacatgg
agaatgatgggctaccacaaccacagcagcggcatgcacagcactcaccgcatgtttggc
tgtgagatccaggaagatggccactccaacagcttctggcagtttggctatgatgggcaa
gaccacgtgtcactggacatggaaactctgagttgggtgtcagctaaccccgtggctctg
ttgaccaagcgtagaatggagacagagcactgctatgctgagtacaacaaagcctacctg
gaaggcccctgcctcgcctccctgcgcagatacctggagctgggaggccagagattcacc
cggagagaaccacccacagtacgggtgacaaagcactcagcccaggacgggggtaccacc
ctgaggtgctgggccctgggcttctatccacaagacatcacactgagctggtggctgggt
gagaagaagttgaattcaaagcttgagtatgtggaggcacgccccagtggagatggcacc
tatcagacgtggatggccgtgtgggtgccggctggagatgagacccaatacacatgccac
gtgcagcactgcagcctgaatcacacgctcactgtgtcctgggaaatgccctctcatcca
agacttacggccgtggttctctctctcatcctgatcttgctggtgattggtggtggtgtg
agtttgaccaagtgccttcaagccaggaataaggaaccttacgagcaacccccaggtgac
tgtggttaa

DBGET integrated database retrieval system