KEGG   Bos mutus (wild yak): 102268179
Entry
102268179         CDS       T02919                                 

Gene name
LPAR3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom04015  Rap1 signaling pathway
bom04072  Phospholipase D signaling pathway
bom04080  Neuroactive ligand-receptor interaction
bom04151  PI3K-Akt signaling pathway
bom05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102268179 (LPAR3)
   04072 Phospholipase D signaling pathway
    102268179 (LPAR3)
   04151 PI3K-Akt signaling pathway
    102268179 (LPAR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102268179 (LPAR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268179 (LPAR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bom04030]
    102268179 (LPAR3)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102268179 (LPAR3)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 102268179
NCBI-ProteinID: XP_005905104
UniProt: L8HZC6
LinkDB
Position
Un
AA seq 353 aa
MNECYYDKRMDFFYNRSNTDTADEWTGTKLLIVLCFGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVYLMFNTGPVSKTLTVNRWFLRQGLLDASLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILFIWAIAIFMGAVPTLGWNCLCDISACSSLA
PIYSRSYLIFWTVSNLMAFFIMVVVYLRIYMYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCTRCNVQHVKRWFLLLALCNSVMNPIIYSYKDEDM
YSTMKRMLCCFSQENPERRPSRLPSMVLSRSDTGGSQYTEDNNRGPVCNKSSS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaatgagtgttactatgataagcggatggactttttttataataggagcaacactgac
actgctgatgagtggacaggaacgaagcttttaattgttttgtgttttggaacgtttttc
tgcctgtttatctttttttctaattctctagtcatcgcagcagtgatcaaaaacagaaag
tttcacttccccttctactacctgctggctaacctagctgctgcagacttctttgctgga
attgcctatgtgtacctgatgtttaacactggcccagtttcaaaaactctgactgtcaac
cggtggtttctccgccagggacttctggacgctagcttaacagcctccctgaccaatttg
ttggttattgccgtggaaaggcacatgtcgatcatgaggatgcgggtccacagcaacctg
accaaaaagagggtgacgctgctcatcttgttcatctgggccatcgccatctttatgggg
gctgtccccacgctgggctggaattgcctctgtgacatctctgcctgctcttccctggcc
cccatttatagcaggagttacctcattttctggactgtgtccaacctcatggccttcttc
attatggtcgtggtgtacctgcggatctacatgtatgtaaagaggaaaaccaacgtcttg
tctccacatacgagtgggtccatcagccgccggaggacacccatgaagctaatgaagacg
gtgatgactgtcttaggggccttcgtcgtgtgctggacgcccggcctggtggttctgctg
ctcgacggcctgaactgcacgcggtgcaacgtgcagcacgtgaaaaggtggttcctgctg
ctggcgctgtgcaactccgtcatgaaccccatcatctactcctacaaggatgaggacatg
tacagcaccatgaagaggatgctctgctgcttctcgcaagagaacccggagaggcggccc
tcccgcctcccctccatggtcctcagccggagcgacacggggggcagccagtatacggag
gataacaaccgaggccccgtctgcaacaagagcagctcgtag

DBGET integrated database retrieval system