KEGG   Bos mutus (wild yak): 102268181
Entry
102268181         CDS       T02919                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04110  Cell cycle
bom04218  Cellular senescence
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102268181 (E2F2)
   04218 Cellular senescence
    102268181 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268181 (E2F2)
   05206 MicroRNAs in cancer
    102268181 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102268181 (E2F2)
   05225 Hepatocellular carcinoma
    102268181 (E2F2)
   05226 Gastric cancer
    102268181 (E2F2)
   05214 Glioma
    102268181 (E2F2)
   05220 Chronic myeloid leukemia
    102268181 (E2F2)
   05218 Melanoma
    102268181 (E2F2)
   05219 Bladder cancer
    102268181 (E2F2)
   05215 Prostate cancer
    102268181 (E2F2)
   05224 Breast cancer
    102268181 (E2F2)
   05222 Small cell lung cancer
    102268181 (E2F2)
   05223 Non-small cell lung cancer
    102268181 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102268181 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102268181 (E2F2)
   05161 Hepatitis B
    102268181 (E2F2)
   05160 Hepatitis C
    102268181 (E2F2)
   05163 Human cytomegalovirus infection
    102268181 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102268181 (E2F2)
   05169 Epstein-Barr virus infection
    102268181 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102268181 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102268181 (E2F2)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102268181 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102268181
NCBI-ProteinID: XP_014336755
LinkDB
Position
Un
AA seq 556 aa
MPSSFASPPPRSGSSPELPLVLRSPPRLLEAGAGAGPRPTWPGARLGGAKIVPPRPRPRP
GDPRSPPRAPGLRSDRGGLDAPPPRFLPRQFCPNRAAALARTPFLPSFILFRQLAFLERL
RRARHEASPTFRVQAPGPTGVLREDSALRPISLPTPPDSSISDVRAPKTAAPKSLAVCWT
PKQGVIAKADPYALLSQPQQPRGDNTDKGPSLVGRLHQSAKRKLDLEGIGRPTVPEFRTP
KGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQ
KRRIYDITNVLEGIQLIRKKAKNNIQWVGRGLFEDPTRPGKQQQLGQELKELMNMEQALD
QLIHSCSLNFKHLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEE
NLQIHLKSTQGPIEVYLCPEEVQEPHSPAKEPLPSTSALSPSPDSTQLNSNSDPGITEPT
ASSEPALTSPQNMLELPHPLLQQTEDQFLSPTLPCSSPLISFSPPLDQDDYLWGLDGGEG
ISDLFDTYDLGDLLIN
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgccatcttcctttgcttcccctccacctcgatctggcagttccccagaactgcctctg
gtgctccgctccccgccaaggcttctggaggccggagcaggggcggggcctcggcccacg
tggcccggagcccggctgggcggggccaagatagtcccgccccggccccgcccccggccc
ggcgacccgcgctcccccccgcgggccccggggctgcgctcggaccgcggcggcctcgac
gcgcccccaccccgcttcctgcctcggcagttttgcccgaaccgggcggccgccctggct
cgcaccccgttccttccttccttcattcttttcaggcaacttgcattcctcgagcgcctg
cgacgtgcccggcacgaggcctctccgaccttccgagtgcaggcccccgggcccaccggg
gtcctccgggaagattccgccctccgccccatctccctccctactccgcccgactcttct
atctctgatgtccgggccccgaagacggccgctcccaagtctctagcagtgtgttggacc
ccaaagcagggagtgattgccaaggctgacccctacgccctgctctctcagccccagcag
ccccggggagacaatacagataaaggacccagcctagtgggccgcctgcatcaatctgcc
aaaaggaagctggacctggaggggatcgggaggcccacggtccctgaattccggactccc
aaggggaagtgcattagagtggatggcctccccagccccaaaacccccaagtcccccgga
gaaaagactcgctatgacacatcgctggggctgctcaccaagaaattcatttacctcctg
agtgagtctgaggatggggttctggatctgaactgggctgccgaagtgctggacgtgcag
aagcggcgcatctacgacatcaccaacgtgctggagggcatccagctcatccgcaagaag
gccaagaacaacatccagtgggtgggcaggggactgtttgaagaccccacgcggcctggg
aagcagcagcagctggggcaggagctgaaggagctgatgaacatggagcaggccctggac
cagctcatccacagctgctctctgaacttcaagcacctgacggaggacaaggccaacaag
agactggcctacgtgacgtaccaggacatccgtgctgtgggcaactttaaggagcagacg
gtgattgcggtcaaggcccctccgcagacgagactggaggtgcctgacaggagtgaggag
aacctgcagatacatctgaagagcacacaggggcccatcgaggtttacctgtgcccagaa
gaggtgcaggagccccacagtcctgccaaggagcccctcccctccacttccgccctcagc
cccagccctgactccacccagctcaacagcaacagcgaccctgggatcacggaacccacg
gcatcctcagagccagcactgacgtccccgcagaacatgctggagctgccgcacccgctg
ctgcagcagacggaggaccagttcctgtccccaacgctgccctgcagctcccctctgatc
agcttctccccgcccttagaccaggatgactacctgtggggcctggacggcggggagggc
atcagcgacctctttgacacctacgatctcggggacctgctgattaactga

KEGG   Bos mutus (wild yak): 102270876
Entry
102270876         CDS       T02919                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04110  Cell cycle
bom04218  Cellular senescence
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102270876 (E2F3)
   04218 Cellular senescence
    102270876 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102270876 (E2F3)
   05206 MicroRNAs in cancer
    102270876 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102270876 (E2F3)
   05225 Hepatocellular carcinoma
    102270876 (E2F3)
   05226 Gastric cancer
    102270876 (E2F3)
   05214 Glioma
    102270876 (E2F3)
   05220 Chronic myeloid leukemia
    102270876 (E2F3)
   05218 Melanoma
    102270876 (E2F3)
   05219 Bladder cancer
    102270876 (E2F3)
   05215 Prostate cancer
    102270876 (E2F3)
   05224 Breast cancer
    102270876 (E2F3)
   05222 Small cell lung cancer
    102270876 (E2F3)
   05223 Non-small cell lung cancer
    102270876 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102270876 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102270876 (E2F3)
   05161 Hepatitis B
    102270876 (E2F3)
   05160 Hepatitis C
    102270876 (E2F3)
   05163 Human cytomegalovirus infection
    102270876 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102270876 (E2F3)
   05169 Epstein-Barr virus infection
    102270876 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102270876 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102270876 (E2F3)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102270876 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102270876
NCBI-ProteinID: XP_014334427
LinkDB
Position
Un
AA seq 364 aa
MFSGPAKATGPYKDLTDYVGADDDMQRASQAKRRLELGESGQQYLSDGLKTPKGKGRAAL
RSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDI
TNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCT
LDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLAS
TQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLA
SPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVED
FMCS
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgttctctgggccagccaaagcaacaggcccatataaggatttgacggactatgtggga
gcagatgatgacatgcagagggcttcccaggcaaagcgcaggctggagctaggagaaagc
ggccagcagtacctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactc
cggagtccagacagcccaaaaactccaaaatctccctcagaaaaaacacggtatgataca
tcccttggtctgctcaccaagaagttcattcagctcctgagccagtcacctgatggggtc
ttggatttgaacaaggcggcagaggtgctgaaggtgcaaaagagaaggatttacgacatc
accaacgtcctggaaggcatccacctcattaagaagaagtctaaaaacaacgtgcagtgg
atgggctgcagtctgtctgaggacgggggcatgctggcccagtgtcaaggcctgtcaaaa
gaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgcacc
ctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttacatat
caagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcccct
ccagaaacaagacttgaagtgcctgacccaatagagagcctacaaatacatttggcaagt
acccaaggacccattgaggtttatttgtgtccagaagagactgaaacacacagtccaatg
aaaacaaacaaccaagaccacaatgggaatatccctaaacccacttccaaagacttggct
tcaaccaactcaggacatagtgattgctcgatttctatggcaaacctttctcctctggcc
tccccggccaaccttttacagcagactgaggaccaaattccttccaacctagaaggacca
tttgtgaacttactgcctcccctgctccaagaagactatctcctaagcctcggggaggaa
gaaggcatcagcgatctctttgatgcttacgatttggaaaagctcccgctggtggaagac
tttatgtgtagttga

KEGG   Bos mutus (wild yak): 102274863
Entry
102274863         CDS       T02919                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
bom  Bos mutus (wild yak)
Pathway
bom01522  Endocrine resistance
bom04110  Cell cycle
bom04137  Mitophagy - animal
bom04218  Cellular senescence
bom04934  Cushing syndrome
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05163  Human cytomegalovirus infection
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05219  Bladder cancer
bom05220  Chronic myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102274863 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    102274863 (E2F1)
   04218 Cellular senescence
    102274863 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102274863 (E2F1)
   05206 MicroRNAs in cancer
    102274863 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102274863 (E2F1)
   05225 Hepatocellular carcinoma
    102274863 (E2F1)
   05226 Gastric cancer
    102274863 (E2F1)
   05214 Glioma
    102274863 (E2F1)
   05220 Chronic myeloid leukemia
    102274863 (E2F1)
   05218 Melanoma
    102274863 (E2F1)
   05219 Bladder cancer
    102274863 (E2F1)
   05215 Prostate cancer
    102274863 (E2F1)
   05224 Breast cancer
    102274863 (E2F1)
   05222 Small cell lung cancer
    102274863 (E2F1)
   05223 Non-small cell lung cancer
    102274863 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102274863 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102274863 (E2F1)
   05161 Hepatitis B
    102274863 (E2F1)
   05160 Hepatitis C
    102274863 (E2F1)
   05163 Human cytomegalovirus infection
    102274863 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102274863 (E2F1)
   05169 Epstein-Barr virus infection
    102274863 (E2F1)
   05165 Human papillomavirus infection
    102274863 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102274863 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102274863 (E2F1)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102274863 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 102274863
NCBI-ProteinID: XP_005896999
LinkDB
Position
Un
AA seq 432 aa
MGRSLEVGLRTQKRGGAVSRDLAEGVGATVSPLRGIGQMGVRRGGGGATTPRTGAVPSEG
GECERAWHRPDKACARPDPRLAVKRRLNLETDHQYLAESSGPARGRGRHPGKGVKSPGEK
SRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIHLIAKKSK
NHIQWLGSHATVGISGRLEGLTQDLQQLQESEQQLDHLLHICSTQLRLLSEDADSQRLAY
VTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEESVGG
TSPGKTPSQGAASGEEDRTADLATAVPPPPSSPRSSPATDPSQSLLSLEQEPLLSRMGGL
RAPVDEDRLSPLGAADSLLEHVKEDFSSLLPEEFITLSPPHEALDYHFGLEEGEGIRDLF
DCDFGDLTPLDF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgggccggagcttggaggtgggcctgagaacccagaagagaggaggggcagtttctaga
gatctggccgagggtgttggggccacagtgtctccacttagaggcatcgggcagatgggg
gtgcgtcggggagggggtggggccaccacgcctcggacaggggccgtcccctctgagggc
ggggagtgcgaacgcgcctggcaccgccccgacaaagcttgcgcgcgccccgacccccga
ttggccgtgaagcggaggctgaacctggaaactgaccatcaatacctggctgagagcagc
gggccagctcggggcagaggccgccacccaggaaaaggtgtgaagtccccaggggagaag
tcacgctacgaaacatcattgaacctgaccaccaaacgcttcttggaattactgagccgc
tcggctgatggagtggtcgacttgaactgggcggcagaggtgctgaaggtgcagaaacgg
cgcatctacgacatcaccaacgtcctggagggcatccacctcatcgcgaagaagtccaag
aaccacatccagtggctaggcagccatgcaacggtggggatcagcgggcggcttgaagga
ttgacccaggacctccagcaactgcaggagagtgagcagcagctggatcacctgctccac
atctgcagcacccagctgcgtctgctctcggaggatgctgacagccaacgcctggcctat
gtgacctgccaggaccttcgtagcatcgcagaccctgcagagcagatggtcatggtgatc
aaggctccccctgagacccagctccaagccgtggactcctcggagaactttcagatctcc
cttaagagcaaacaaggccccatcgacgttttcctgtgccctgaggagagtgtgggtgga
accagccctggaaagaccccgtcccagggggcagcttcgggggaggaggacaggacagct
gaccttgccactgcggtgccaccaccaccatcatcaccccgctcatcccctgccacagat
cccagtcagtccctgctcagcctggagcaagaacctctgctttcccggatgggcggcctg
cgggcccccgtggacgaggaccgcctatccccgctcggggcggccgactcactcctggag
cacgtgaaggaggacttctccagcctcctccccgaggagttcatcaccctgtcccccccc
cacgaggccctcgactaccactttggcctcgaggagggtgagggcatcagagacctcttc
gactgtgactttggggacctcactcccctggatttctga

DBGET integrated database retrieval system