KEGG   Bos mutus (wild yak): 102268312Help
Entry
102268312         CDS       T02919                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102268312 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102268312 (KMT5B)
Enzymes [BR:bom01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102268312 (KMT5B)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102268312 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 102268312
NCBI-ProteinID: XP_014338114
LinkDB All DBs
Position
Un
AA seq 866 aa AA seqDB search
MKWLGESKNMVVNGRRHGGKLSNDHQQNQSKLQHSGKDNVKAGRNAGERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPPRSSRHFSKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQGRNDATSNRKSSVGVKKNSKSRTLTRQSMSRIPA
PPNSTSSKLTPINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEPKSASRKLEMGNLVLKEP
KVVLYKNLPIKKEKEPEGPVEATVASGCLTRHAAREHRQNSERGAPSHAEGAPCTYTTRR
SVRTRMTLKETSDIKLEPNTLEGYRSDLTEPCPDGGEQPAPGAPDEELAHEAAQKGEARC
PKSDSSTSKKKSQPGKLVRQLAKAEEAGAHPDSGEHSGVEGVPGGYADWAPSPVSASMVT
SESFKTKDGFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRRHDSSSKANDQESDGMN
SSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKRDEESRGPYAEGLHENG
VCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGEDEDEEYDDDFEDDFIPLPPAKRLR
LIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagacatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaagttacagcactcgggaaaggacaacgtg
aaggctggcagaaacgcaggcgagaggaggtcgagcagatgtaatgggaactcaggcttt
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggaactctgtgaaaat
gatgacctagcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttcctccgaggagctcaaggcatttttcaaaatctgacagtttttct
cacaacaaccctgtaagatttcggcctattaaaggaaggcaggaagaactcaaagaagta
attgaacgttttaagaaagatgagcacttggagaaagccttcaaatgtctgacttcagga
gaatgggcacggcactattttctcaacaagaacaaaatgcaggagaaattattcaaggaa
catgtatttatttatttgcgaatgtttgcaactgacagtggatttgaaatattgccttgt
aatagatactcttcagaacaaaatggagccaaaatagttgcaacgaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctgcttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcctgctgcatttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggccctaagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaacaatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatacggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaactcagacagtcagtctgtcagctccaacact
gacgcagacaccactcagggaagaaacgacgcaacttctaaccgaaaatcttcagttggt
gtaaaaaagaacagcaagagcagaacattaacaaggcagtctatgtcaagaattccagct
cctcccaactctacctcatctaagctaactcctataaataattccagggtaccaaagaaa
ctgaaaaaacctgcaaagcctttactatcaaagataaaattaagaaatcattgcaaacgg
ctggagccgaagagtgcttctagaaaactcgaaatgggaaacttggtactgaaagagcct
aaagtcgttctgtacaaaaatttgcccattaaaaaagagaaggaaccagagggaccagtg
gaggccacggtggccagtgggtgcttaaccagacacgctgcgagagagcacagacagaac
tcggagcgaggcgccccttcgcacgcggagggcgccccctgcacctacacaaccaggcgg
tccgtgaggacgaggatgaccttgaaggagacctccgacatcaagcttgaaccaaatacg
ctggagggctacagaagtgacttgacagaaccttgcccagatggcggcgagcagcccgct
cccggggcgccggacgaagagctggcccacgaagctgcacagaagggggaagccaggtgt
cctaagagcgacagcagcacgtccaaaaagaagtcacagccgggtaagctggtgcggcag
ctggcaaaggcagaggaagccggggcccaccccgactcgggcgagcacagcggcgtggag
ggcgtgcccgggggctacgcggactgggccccttcgcccgtcagtgcttccatggtgacg
tcagagagcttcaaaacaaaagacggcttccgaactgcgaaaagtaaaaaaaagaggcgg
atcacgaggtatgacgcacagttaatcctggaaaataactctgggattcccaagttgact
cttcgcagacgtcatgacagcagcagcaaggcaaatgaccaagagagtgatgggatgaat
tcttcaaaaatcagcatcaagttgagtaaagaccatgaaaatgataataacctctatgta
gcaaagcttaacaatggatttaactcaggatcaggcagtagttcaacaaaattaaaaatc
cagctaaagcgggacgaggaaagtagggggccgtacgccgaggggcttcacgaaaacggc
gtgtgctgtagtgaccccctgtccctcctggagtcgcgtatggaagtggatgactacagt
cagtacgaggaggagagcacagacgactcctcctcctcggagggagaggacgaggacgag
gagtatgacgatgactttgaagacgattttatccctctgcctccggccaagcggttgagg
ctcatagttgggaaagactctatagatattgacatttcttccaggaggagagaagatcag
tctttgaggcttaacgcataa

DBGET integrated database retrieval system