KEGG   Bos mutus (wild yak): 102268388
Entry
102268388         CDS       T02919                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains 1
  KO
K14365  four and a half LIM domains protein 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102268388 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bom04990]
    102268388 (FHL1)
Domain-containing proteins not elsewhere classified [BR:bom04990]
 LIM domain-containing proteins
  FHL family proteins
   102268388 (FHL1)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 102268388
NCBI-ProteinID: XP_005907869
LinkDB
Position
Un
AA seq 339 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDNLQGKKYVQKDGHHCCLKCFDKFCANTCVQCR
KPIGADSKEVHYKNRYWHDTCFRCSKCLQPLASETFVAKDNKILCNKCTTREDNPKCKGC
LKPIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHEAKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttcccatagacactcaggtccttccagctataaagtaggcaccatggctgagaag
ttcgactgccactactgcagagacaacctgcaggggaagaagtacgtgcagaaggacggc
caccactgctgcctcaagtgcttcgacaagttctgtgccaacacgtgtgtgcagtgccgc
aagcccatcggcgccgactccaaggaggtgcactacaagaaccgctactggcacgacacc
tgcttccgctgctctaagtgcctccagcccttggccagtgagaccttcgtggccaaggac
aacaagatcctgtgcaacaagtgcaccactcgggaggacaaccccaagtgcaagggctgc
ctcaagcccattgtagcaggagatcagaacgtggaatacaagggcactgtctggcacaaa
gactgcttcacctgcagcaactgcaagcaagtcatcgggacaggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccatgaggccaagtttgccaagcactgcgtgaaa
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgag
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaacccaatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system