KEGG   Bos mutus (wild yak): 102268417
Entry
102268417         CDS       T02919                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
bom  Bos mutus (wild yak)
Pathway
bom01523  Antifolate resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04064  NF-kappa B signaling pathway
bom04066  HIF-1 signaling pathway
bom04071  Sphingolipid signaling pathway
bom04137  Mitophagy - animal
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04218  Cellular senescence
bom04380  Osteoclast differentiation
bom04620  Toll-like receptor signaling pathway
bom04621  NOD-like receptor signaling pathway
bom04622  RIG-I-like receptor signaling pathway
bom04623  Cytosolic DNA-sensing pathway
bom04625  C-type lectin receptor signaling pathway
bom04657  IL-17 signaling pathway
bom04658  Th1 and Th2 cell differentiation
bom04659  Th17 cell differentiation
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04917  Prolactin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04926  Relaxin signaling pathway
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05010  Alzheimer disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05030  Cocaine addiction
bom05132  Salmonella infection
bom05133  Pertussis
bom05134  Legionellosis
bom05135  Yersinia infection
bom05140  Leishmaniasis
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05146  Amoebiasis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05202  Transcriptional misregulation in cancer
bom05203  Viral carcinogenesis
bom05212  Pancreatic cancer
bom05215  Prostate cancer
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102268417 (RELA)
   04014 Ras signaling pathway
    102268417 (RELA)
   04064 NF-kappa B signaling pathway
    102268417 (RELA)
   04668 TNF signaling pathway
    102268417 (RELA)
   04066 HIF-1 signaling pathway
    102268417 (RELA)
   04071 Sphingolipid signaling pathway
    102268417 (RELA)
   04024 cAMP signaling pathway
    102268417 (RELA)
   04151 PI3K-Akt signaling pathway
    102268417 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102268417 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102268417 (RELA)
   04218 Cellular senescence
    102268417 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102268417 (RELA)
   04621 NOD-like receptor signaling pathway
    102268417 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102268417 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102268417 (RELA)
   04625 C-type lectin receptor signaling pathway
    102268417 (RELA)
   04660 T cell receptor signaling pathway
    102268417 (RELA)
   04658 Th1 and Th2 cell differentiation
    102268417 (RELA)
   04659 Th17 cell differentiation
    102268417 (RELA)
   04657 IL-17 signaling pathway
    102268417 (RELA)
   04662 B cell receptor signaling pathway
    102268417 (RELA)
   04062 Chemokine signaling pathway
    102268417 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102268417 (RELA)
   04917 Prolactin signaling pathway
    102268417 (RELA)
   04926 Relaxin signaling pathway
    102268417 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102268417 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102268417 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102268417 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268417 (RELA)
   05202 Transcriptional misregulation in cancer
    102268417 (RELA)
   05203 Viral carcinogenesis
    102268417 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102268417 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102268417 (RELA)
   05221 Acute myeloid leukemia
    102268417 (RELA)
   05220 Chronic myeloid leukemia
    102268417 (RELA)
   05215 Prostate cancer
    102268417 (RELA)
   05222 Small cell lung cancer
    102268417 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102268417 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102268417 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    102268417 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102268417 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102268417 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102268417 (RELA)
   04931 Insulin resistance
    102268417 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102268417 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102268417 (RELA)
   05135 Yersinia infection
    102268417 (RELA)
   05133 Pertussis
    102268417 (RELA)
   05134 Legionellosis
    102268417 (RELA)
   05152 Tuberculosis
    102268417 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102268417 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102268417 (RELA)
   05162 Measles
    102268417 (RELA)
   05164 Influenza A
    102268417 (RELA)
   05161 Hepatitis B
    102268417 (RELA)
   05160 Hepatitis C
    102268417 (RELA)
   05168 Herpes simplex virus 1 infection
    102268417 (RELA)
   05163 Human cytomegalovirus infection
    102268417 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102268417 (RELA)
   05169 Epstein-Barr virus infection
    102268417 (RELA)
   05165 Human papillomavirus infection
    102268417 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102268417 (RELA)
   05145 Toxoplasmosis
    102268417 (RELA)
   05140 Leishmaniasis
    102268417 (RELA)
   05142 Chagas disease
    102268417 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102268417 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102268417 (RELA)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102268417 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102268417
NCBI-ProteinID: XP_005894159
LinkDB
Position
Un
AA seq 596 aa
MNRVGSVDDLKPTSLRVLRERTRRGASDHANVQQAPRRPRSEYCQVPDLFPLIFPAEPAQ
ASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRIS
LVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQ
TNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLAPVLSHPIFDNRAPNTAELK
ICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTP
PYADPGLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKK
SPFNGPTDPRPPTRRIAVPNRGSASIPKPAPQPYSFTPSLSTINFEEFSPMVFPSGQIPS
QTSALAPAPTPVLTQTQVLAPAPAPAPGMASTLAQALAPGLAQAVTPPAPRTNQTGEGTL
TEALLQLQFDTDEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQGVPMGPHTTEPMLME
YPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADVDFSALLSQISS
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgaacagggtcggcagtgtggatgatcttaaaccgacgagcctgcgggtactgcgcgag
cggacgcggcgcggagcctctgatcacgctaacgtgcagcaggctccgcgaaggccacga
tccgagtactgccaggttccagacctcttccccctcatcttccctgcagagccggcgcag
gcctctggcccctatgtggagatcatcgagcagcccaagcagcggggcatgcgcttccgc
tacaagtgtgagggccgctcagctggcagcatccctggagagaggagcacggacaccacc
aagacccaccccactatcaagatcaatggctacacggggccagggacagtccgcatctcc
ctggtcaccaaggacccccctcaccggcctcacccccacgagctagtggggaaagactgc
cgggatggcttctatgaggctgagctctgcccggaccgctgcatccacagctttcagaac
ctggggatccagtgtgtaaagaagcgggacctggagcaggccatcagccagcgcatccag
accaacaacaaccccttccaagttcccatagaagagcagcgcggggactacgacctgaat
gccgtccggctctgcttccaggtgacagtgcgggacccggcaggcaggcccctccgcctg
gcgcctgtcctctctcaccccatctttgacaaccgcgcccccaacaccgccgagctcaag
atctgccgggtgaatcggaactctgggagctgcctcggcggggatgagatcttcctgctg
tgtgacaaggtgcagaaagaggacatcgaggtgtatttcacgggaccaggctgggaggcc
cgaggctctttttcacaagctgacgtgcaccggcaagtggccatcgtgttccggacgccg
ccctacgcggaccccggcctgcaggcccctgtgcgcgtctccatgcagctgcggcggcct
tccgatcgggagctcagtgagcccatggaattccagtacttgccagacacagacgatcgt
caccggattgaggagaagcgcaaaaggacgtacgagaccttcaagagcatcatgaaaaag
agccctttcaatggacccaccgacccccggcctccaacccggcgcatcgctgtgcctaac
cgcggctcagcctccatccccaagccagctccccagccctattcctttacgccatctctc
agcaccatcaactttgaggagttttcccccatggtctttccttctgggcagatcccaagc
cagacctcggccttggcaccagcccccaccccggtcctgacccagacccaagtcctggcc
ccagccccggccccagccccaggcatggcatcaaccctggcccaggccctagccccaggc
ctggctcaggctgtgaccccgcctgcccccaggaccaaccagacgggggaagggacactg
acagaggccctgctgcagctgcagtttgataccgatgaagacctgggggctctgcttggc
aacaacactgaccctgccgtgttcacagacctggcatctgtcgacaactctgagtttcag
cagttgctgaaccagggtgtacccatgggcccccacacaactgagcccatgctgatggag
taccctgaggctataactcgcctggtgacagggtcccaaaggccccctgacccagctccc
actcccctggggccccctgggctcaccaatggcctcctctcgggggatgaagacttctcc
tccatcgcggatgtggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system