KEGG   Bos mutus (wild yak): 102268592
Entry
102268592         CDS       T02919                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04064  NF-kappa B signaling pathway
bom04066  HIF-1 signaling pathway
bom04071  Sphingolipid signaling pathway
bom04115  p53 signaling pathway
bom04140  Autophagy - animal
bom04141  Protein processing in endoplasmic reticulum
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom04217  Necroptosis
bom04261  Adrenergic signaling in cardiomyocytes
bom04340  Hedgehog signaling pathway
bom04510  Focal adhesion
bom04621  NOD-like receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04915  Estrogen signaling pathway
bom04928  Parathyroid hormone synthesis, secretion and action
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom05014  Amyotrophic lateral sclerosis
bom05022  Pathways of neurodegeneration - multiple diseases
bom05132  Salmonella infection
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05161  Hepatitis B
bom05162  Measles
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05206  MicroRNAs in cancer
bom05210  Colorectal cancer
bom05215  Prostate cancer
bom05222  Small cell lung cancer
bom05226  Gastric cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102268592 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102268592 (BCL2)
   04630 JAK-STAT signaling pathway
    102268592 (BCL2)
   04064 NF-kappa B signaling pathway
    102268592 (BCL2)
   04066 HIF-1 signaling pathway
    102268592 (BCL2)
   04071 Sphingolipid signaling pathway
    102268592 (BCL2)
   04151 PI3K-Akt signaling pathway
    102268592 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102268592 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102268592 (BCL2)
   04215 Apoptosis - multiple species
    102268592 (BCL2)
   04217 Necroptosis
    102268592 (BCL2)
   04115 p53 signaling pathway
    102268592 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102268592 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102268592 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102268592 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    102268592 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102268592 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    102268592 (BCL2)
   04722 Neurotrophin signaling pathway
    102268592 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268592 (BCL2)
   05206 MicroRNAs in cancer
    102268592 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102268592 (BCL2)
   05226 Gastric cancer
    102268592 (BCL2)
   05215 Prostate cancer
    102268592 (BCL2)
   05222 Small cell lung cancer
    102268592 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102268592 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    102268592 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102268592 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102268592 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102268592 (BCL2)
   05152 Tuberculosis
    102268592 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102268592 (BCL2)
   05161 Hepatitis B
    102268592 (BCL2)
   05162 Measles
    102268592 (BCL2)
   05168 Herpes simplex virus 1 infection
    102268592 (BCL2)
   05169 Epstein-Barr virus infection
    102268592 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102268592 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102268592 (BCL2)
   01524 Platinum drug resistance
    102268592 (BCL2)
   01522 Endocrine resistance
    102268592 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102268592 (BCL2)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102268592 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102268592
NCBI-ProteinID: XP_005910250
LinkDB
Position
Un
AA seq 226 aa
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPS
RTSPPPPPAAXXXXXXXXXXXLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV
VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQDNG
GWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgcacgcggggggaacaggctacgataaccgagagatcgtgatgaagtacatccac
tataagctgtcgcagcggggctacgagtgggatgccggagacgcgggcgccgcgcccccc
ggggccgctcccgcgccgggcatcctgtcctcccagccgggccgcacacccgcgccctcc
aggacctccccgccgccgcccccggccgccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nacctgaccctgcgccaggccggcgatgacttctctcggcgctaccgccgcgacttcgcc
gagatgtccagtcaactgcacctgacgcccttcaccgcgaggggacgcttcgccacggtg
gtggaggagctcttcagggacggggtgaactgggggcgcatcgtggccttctttgagttc
ggaggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacagcatc
gccctgtggatgaccgagtacctgaaccggcacctgcacacctggatccaggacaacgga
ggctgggacgcctttgtggagctgtatggccctagcatgcggcccctgtttgatttctcc
tggctgtctctgaaggcactgctcagtctggccctggtgggcgcttgcatcaccctgggt
gcctatctgggccataagtga

DBGET integrated database retrieval system