KEGG   Bos mutus (wild yak): 102268660
Entry
102268660         CDS       T02919                                 

Gene name
CASP9, Caspase-9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01524  Platinum drug resistance
bom04115  p53 signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04215  Apoptosis - multiple species
bom04370  VEGF signaling pathway
bom04919  Thyroid hormone signaling pathway
bom05010  Alzheimer disease
bom05012  Parkinson disease
bom05014  Amyotrophic lateral sclerosis
bom05016  Huntington disease
bom05020  Prion disease
bom05022  Pathways of neurodegeneration - multiple diseases
bom05134  Legionellosis
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05210  Colorectal cancer
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05215  Prostate cancer
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102268660 (CASP9)
   04151 PI3K-Akt signaling pathway
    102268660 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102268660 (CASP9)
   04215 Apoptosis - multiple species
    102268660 (CASP9)
   04115 p53 signaling pathway
    102268660 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102268660 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102268660 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102268660 (CASP9)
   05212 Pancreatic cancer
    102268660 (CASP9)
   05215 Prostate cancer
    102268660 (CASP9)
   05213 Endometrial cancer
    102268660 (CASP9)
   05222 Small cell lung cancer
    102268660 (CASP9)
   05223 Non-small cell lung cancer
    102268660 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102268660 (CASP9)
   05012 Parkinson disease
    102268660 (CASP9)
   05014 Amyotrophic lateral sclerosis
    102268660 (CASP9)
   05016 Huntington disease
    102268660 (CASP9)
   05020 Prion disease
    102268660 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    102268660 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102268660 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102268660 (CASP9)
   05152 Tuberculosis
    102268660 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102268660 (CASP9)
   05161 Hepatitis B
    102268660 (CASP9)
   05160 Hepatitis C
    102268660 (CASP9)
   05164 Influenza A
    102268660 (CASP9)
   05162 Measles
    102268660 (CASP9)
   05168 Herpes simplex virus 1 infection
    102268660 (CASP9)
   05163 Human cytomegalovirus infection
    102268660 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102268660 (CASP9)
   05169 Epstein-Barr virus infection
    102268660 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102268660 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102268660 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102268660 (CASP9)
   01002 Peptidases and inhibitors [BR:bom01002]
    102268660 (CASP9)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102268660 (CASP9)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102268660 (CASP9)
Peptidases and inhibitors [BR:bom01002]
 Cysteine peptidases
  Family C14: caspase family
   102268660 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 102268660
NCBI-ProteinID: XP_005888983
LinkDB
Position
Un
AA seq 475 aa
MLKDTQFHCGQGTELEGYDALERVELGGTDQGSRHDILSRNMTIPHPAPRVYECRELFTP
DMIEDIQRAGSGSRRDQARQLILDLETRGSQALPLFISCLEDTGQDTLASLLKTSRQAAK
QDVEAIRPLDLKPVVLGPEGLKPGELRVMKQDPSKLSQGKLAPVVLGPEELWPPKLRPEV
LRPEVPRAVDAGSGGFTDVCPQDRAKGNADLAYVLNADPCGHCLIINNVNFCRESGLRAR
TGSNIDCERMRRRFHLLQFVVEVKCDLTAKQMVQALMQLARQDHSAVDCCVVVILSHGCQ
ASHLRFPGAVYGTDGCPVSVERIVNTFNGTGCPSLRGKPKLFFIQACGGEQKDHGFEVES
TSPEDKTPSSDPEADATPFQEGPRSIDEPDAVSSLPTPSDILVSYSTFPGFVSWRDPKSG
SWYIETLDSIFEQWAHCEDLQTLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKT
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgctaaaggatactcagtttcactgcggacaggggacagagctagaggggtacgatgcc
ctggagcgggttgaactgggcgggacagaccaaggctccaggcacgacattcttagtaga
aatatgaccatcccccaccccgccccgagagtttatgaatgtcgcgagctcttcactccc
gacatgatcgaggacattcagagggcaggctcaggctctcggcgtgatcaggccaggcaa
ctaatcctagatctagagactcgagggagtcaggcccttcctttgttcatctcctgcttg
gaggacacaggccaggacactctggcttcattattgaagaccagcagacaagcagcaaaa
caggatgtggaggccatcagacccctggatctcaagccggtggtacttggaccagagggc
ctcaaaccaggggagctgagagtgatgaagcaggacccatcaaagctgagccaaggaaaa
ctcgctccagtggtgctggggccggaggagctctggccacccaagctcaggcctgaggtt
ctcagaccagaggtacccagggcagtggacgctggttctggaggattcactgatgtctgt
cctcaggacagagccaagggaaatgccgatctggcctatgtcctgaacgcagacccctgc
ggccactgcctgatcatcaacaacgtgaacttctgccgcgagtcggggctcagggcccgc
acgggctccaacatcgactgtgagaggatgcggcgacgcttccacctgctgcagtttgtg
gtggaggtgaaatgtgacctgactgccaagcaaatggtccaggctttgatgcagctggcg
cggcaggaccacagcgctgtggactgctgcgtggtggtcatcctgtctcacggctgtcag
gctagccacctccggttcccaggggctgtttatggcacagatggatgtcctgtgtccgtc
gagagaattgtgaacactttcaatggtactggctgccccagcttgagagggaagcccaag
cttttcttcatccaggcctgtggtggagagcagaaagaccacgggtttgaggtggagtcc
acttcccctgaagataagacccccagtagcgaccctgaggcggatgctaccccattccag
gaaggcccacgttccattgacgagccagatgccgtgtctagtttgcccacgcccagcgac
atcttggtgtcctactccaccttcccaggctttgtctcctggagggatcccaagagcggc
tcctggtacatcgagaccctggacagcatttttgagcagtgggctcactgtgaggacctt
cagaccctcctcctcagggtcgctaatgctgtttcagtgaaaggaatttacaaacagatg
ccgggctgttttaatttcctccggaaaaaacttttctttaaaacataa

DBGET integrated database retrieval system